MMACHC

Methylmalonic aciduria and homocystinuria type C protein

282 amino acids

Catalyzes the reductive dealkylation of cyanocobalamin to cob(II)alamin, using FAD or FMN as cofactor and NADPH as cosubstrate (PubMed:19700356, PubMed:21697092, PubMed:22642810). Can also catalyze the glutathione-dependent reductive demethylation of methylcobalamin, and, with much lower efficiency, the glutathione-dependent reductive demethylation of adenosylcobalamin (PubMed:19801555, PubMed:22642810, PubMed:25809485). Under anaerobic conditions cob(I)alamin is the first product; it is highly reactive and is converted to aquocob(II)alamin in the presence of oxygen (PubMed:19801555). Binds cyanocobalamin, adenosylcobalamin, methylcobalamin and other, related vitamin B12 derivatives (PubMed:21071249).

Belongs to the MMACHC family.

31.728 kDa

MEPKVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPLPGPTLAFLVLSTPAMFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP

MMACHC

Methylmalonic aciduria and homocystinuria type C protein homolog

280 amino acids

Catalyzes the reductive dealkylation of cyanocobalamin to cob(II)alamin, using FAD or FMN as cofactor and NADPH as cosubstrate. Can also catalyze the glutathione-dependent reductive demethylation of methylcobalamin, and, with much lower efficiency, the glutathione-dependent reductive demethylation of adenosylcobalamin. Under anaerobic conditions cob(I)alamin is the first product; it is highly reactive and is converted to aquocob(II)alamin in the presence of oxygen. Binds cyanocobalamin, adenosylcobalamin, methylcobalamin and other, related vitamin B12 derivatives.

Belongs to the MMACHC family.

31.633 kDa

MEPLVAELKQKIEDTLCPFGFEVYPFQVAWYNALLPPAFHLPLPGPTLAFLVLSTPAMFDQALKPFLQSHHLQPLTDPVDQCVAYHLGRVRESLPELQIEVIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVESDPWGTQHIAGVCIHPRFGGWFAIRGVVLLRGTEVPNLPPTKPVDCVPTRADRISLLERFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLLQPSEEPSSPSQELHITTLLSKKPQNPRRGWLSPTVSPPISPGP

Mmachc

Methylmalonic aciduria and homocystinuria type C protein homolog

279 amino acids

Catalyzes the reductive dealkylation of cyanocobalamin to cob(II)alamin, using FAD or FMN as cofactor and NADPH as cosubstrate. Can also catalyze the glutathione-dependent reductive demethylation of methylcobalamin, and, with much lower efficiency, the glutathione-dependent reductive demethylation of adenosylcobalamin. Under anaerobic conditions cob(I)alamin is the first product; it is highly reactive and is converted to aquocob(II)alamin in the presence of oxygen. Binds cyanocobalamin, adenosylcobalamin, methylcobalamin and other, related vitamin B12 derivatives.

Belongs to the MMACHC family.

31.648 kDa

MEPRVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPFPGPTLAFLVLSTPAMFDRALKPFLKSCHFQTLRDPVDQCVSYHLRSVTEKFPEVHMEVIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVDADPWGTQHIAGVCIHPRFGGWFAIRGVMLLPGIEVPNLPPRKPPDCVPTRAGRITLLEGFNFHWRDWTYRDAVTPEERYSEEQKIYFSTPPAQRLALLGLAQPSEHPSTTSELPLSLLTKPQNSRRARSWLSPSVSPPVSPGP

mmachc

Methylmalonic aciduria and homocystinuria type C protein homolog

250 amino acids

Catalyzes the reductive dealkylation of cyanocobalamin to cob(II)alamin, using FAD or FMN as cofactor and NADPH as cosubstrate. Can also catalyze the glutathione-dependent reductive demethylation of methylcobalamin, and, with much lower efficiency, the glutathione-dependent reductive demethylation of adenosylcobalamin. Under anaerobic conditions cob(I)alamin is the first product; it is highly reactive and is converted to aquocob(II)alamin in the presence of oxygen. Binds cyanocobalamin, adenosylcobalamin, methylcobalamin and other, related vitamin B12 derivatives.

Belongs to the MMACHC family.

28.716 kDa

MAISSERVEELLRTFRESLKAKGFEIYPFKVGWYNAVLTAAHHLQYPADTLAVLVISTPAMFECAFLPFLQSQSCESLRDPIDQCTAHTLSACISLCFANQFVDVSYDYEMLPSRKPKFLAQTAAHVSGAAYYYQTSDIHNPPWGEKKMFGVCVHPQLGGWFAIRALLVFRDVQAGAGFQQRDPADCVCTQEERIRLLESFNLRWRDWSYRDIVPAEDRYSDQQKQYFITPPGQRRALLRQWGYLTDTQS

MMACHC

Methylmalonic aciduria and homocystinuria type C protein homolog

238 amino acids

Catalyzes the reductive dealkylation of cyanocobalamin to cob(II)alamin, using FAD or FMN as cofactor and NADPH as cosubstrate. Can also catalyze the glutathione-dependent reductive demethylation of methylcobalamin, and, with much lower efficiency, the glutathione-dependent reductive demethylation of adenosylcobalamin. Under anaerobic conditions cob(I)alamin is the first product; it is highly reactive and is converted to aquocob(II)alamin in the presence of oxygen. Binds cyanocobalamin, adenosylcobalamin, methylcobalamin and other, related vitamin B12 derivatives.

Belongs to the MMACHC family.

27.637 kDa

MEERVAERLHGALGPLGFEVHAFKVGWYNAVLQPAFHLPYPDDTLAFVVLSTPSMFDKALKPFVNKERLKIIRDPVDQCVSHHLSSVKEIFPDQKVDVIFDYEILPSRRPKFLAQTAAHVAGAAYYYQRKDVKLDPWGEKKIFGVCIHPKYGGWFAIRGLLLFPDVQVPFLEQSAPVDCVSTEEKRTELLELFNFHWQDGRYRDIIEVKERYSEEQKTYFSTPPAERFRLLGLTRFTE