MIF3

Mini zinc finger protein 3

113 amino acids

Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties.

11.86 kDa

MMKRLVVLRRREPAVRFSCCGVRYGECRRNHAASTGGHAVDGCREFIAAEDGGGGNSTGAVGVAAAALKCAACGCHRSFHRRVQVYEVAWDDDCDSGDTSSSSPSSSSSLSSE

MIF3

Mini zinc finger protein 2

113 amino acids

Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties.

11.846 kDa

MMKRLVVLRRREPAVRFSCCGVRYGECRRNHAASTGGHAVDGCREFIAAEDGGGGNSTSAVGVAAAALKCAACGCHRSFHRRVQVYEVAWDDDCASGDTSSSSPSSSSSLSSE

MIF3

Mini zinc finger protein 3

88 amino acids

Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins.

9.751 kDa

MKKRQVVIKQRKSSYTMTSSSSNVRYVECQKNHAANIGGYAVDGCREFMASGGDDALTCAACGCHRNFHRREVDTEVVCEYSPPNANN