mief2

Mitochondrial dynamics protein MID49

463 amino acids

Mitochondrial outer membrane protein which regulates mitochondrial organization (By similarity). It is required for mitochondrial fission and promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface independently of the mitochondrial fission FIS1 and MFF proteins (By similarity). Regulates DNM1L GTPase activity (By similarity).

Belongs to the MID49/MID51 family.

51.991 kDa

MAELQIRKKEKKSGDGIGTMVDFLLANARLVLGVGGAAMLGIATLAVKRLIDRATSPPSDKEAEEKAEQKSIEESWKEAVLKKASPTLRRKEDLEHHCAPLSLPDPSQKMPEATGTSQVKASDEIKKIPICFTLQERLLNYHTHHASVPEVQMEEARQLVLDIKKELQEFLHAKHPEMPFLALHLGGSFGNRLPMSCLDHACLIMPLVLEPDLWCVIPGQKTILSDPNFCMVKRIDLEYTSRGSSPWDRFLVGAYLSSRTMVQSLHKTIVGSINWPAIGTVLDCTIKPDITSDELKLEVVHPNGHMIIRILPMAVIKDADLLAHCCATAPAENLWQRSFYKKEVSRLQELDSSDSGIRLKCLQILKGICRDCPSLCHLNSTHLRHILLHLSTESSDWTETALADRFLQVLEELIGYLDKGFLPSYFNDKLNLFSSLKAEDIEELGYGLYQVFSEPDDVLKRER

MIEF2

Mitochondrial dynamics protein MID49

454 amino acids

Mitochondrial outer membrane protein which regulates mitochondrial organization (PubMed:29361167). It is required for mitochondrial fission and promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface independently of the mitochondrial fission FIS1 and MFF proteins. Regulates DNM1L GTPase activity.

Belongs to the MID49/MID51 family.

49.269 kDa

MAEFSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDRATSPRDEDDTKADSWKELSLLKATPHLQPRPPPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLLVPLVLEPGLWSLVPGVDTVARDPRCWAVRRTQLEFCPRGSSPWDRFLVGGYLSSRVLLELLRKALAASVNWPAIGSLLGCLIRPSMASEELLLEVQHERLELTVAVLVAVPGVDADDRLLLAWPLEGLAGNLWLQDLYPVEAARLRALDDHDAGTRRRLLLLLCAVCRGCSALGQLGRGHLTQVVLRLGEDNVDWTEEALGERFLQALELLIGSLEQASLPCHFNPSVNLFSSLREEEIDDIGYALYSGLQEPEGLL

Mief2

Mitochondrial dynamics protein MID49

454 amino acids

Mitochondrial outer membrane protein which regulates mitochondrial organization. It is required for mitochondrial fission and promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface independently of the mitochondrial fission FIS1 and MFF proteins. Regulates DNM1L GTPase activity.

Belongs to the MID49/MID51 family.

49.624 kDa

MAEFSQKQRKQSGSEGLGSVVDFLLANARLVLGVGGAAVLGIATLAVKRLIDRATSPPDEDDTKGDSWKELSLLRATSPQKPQPPPAAFSQPLATGSPSPSVPVEPTPIHSPTTPKFSTIAPLCLTFQERLLAFERKHVITPEAHVTLAKQLAGDIALELQAYLRSKFPELPFGALVPGGPLYDGLQAGTAEHVRLLAPLELEPGLWSLVPGVDTVAREPRCWAVRRTQLEFHPRGCSPWDRFLVGGYLSSRVLLELLRKALSASVNWPAIGSLLGCLIWPDVASEELLLKVQHECLEFTLAVLMVVPGASTDDRLLLAWPLEGLASNLWLQDLYPVETARLRALDDQDAGTRRRLLLLLCGICRGHPALVRLGWSHLTQVVLHLGEEEVAWTEEALGERFLQALEFLVGSLEQASLPCHFNPSVNLLGNFREEEIDDIGYVLYSGLQVPESLF

MIEF2

Mitochondrial dynamics protein MID49

454 amino acids

Mitochondrial outer membrane protein which regulates mitochondrial organization (By similarity). It is required for mitochondrial fission and promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface independently of the mitochondrial fission FIS1 and MFF proteins (By similarity). Regulates DNM1L GTPase activity (By similarity).

Belongs to the MID49/MID51 family.

49.27 kDa

MAEFSQKRGKRRGDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDRATSPRDEDDTKADSWKELSLLKATPHLQPRPPPAALSQPVLPLAPSSSAPEGPAKSDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFQSKFPELPFGAFVPGGPLYDGLQAGAADHVRLLVPLVLEPGLWSLVPGVDTVARDPRCWAVRRTQLEFCPRGSSPWDRFLVGGYLSSRVLLELLRKVLAASVNWPAIGSLLGCLIRPSMASEELLLEVQHERLELTVAVLVAVPGVDADDRLLLAWPLEGLAGNLWLQDLYPVEAARLRALDDRDAGTRRRLLLLLCAVCRGCSALGQLGRGHLTQVVLRLGEDNVDWTEEALGERFLQALELLIGSLEQASLPCHFNPSVNLFSNLREEEIDDIGYALYSGLQEPEGLL