MICU2

Calcium uptake protein 2, mitochondrial

434 amino acids

Key regulator of mitochondrial calcium uniporter (MCU) required to limit calcium uptake by MCU when cytoplasmic calcium is low (PubMed:24503055, PubMed:24560927, PubMed:26903221). MICU1 and MICU2 form a disulfide-linked heterodimer that stimulate and inhibit MCU activity, depending on the concentration of calcium (PubMed:24560927). MICU2 acts as a gatekeeper of MCU that senses calcium level via its EF-hand domains: prevents channel opening at resting calcium, avoiding energy dissipation and cell-death triggering (PubMed:24560927).

Belongs to the MICU1 family. MICU2 subfamily.

49.666 kDa

MAAAAGSCARVAAWGGKLRRGLAVSRQAVRSPGPLAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQTAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVAFKMLDTDGNEMIEKREFFKLQKIISKQDDLMTVKTNETGYQEAIVKEPEINTTLQMRFFGKRGQRKLHYKEFRRFMENLQTEIQEMEFLQFSKGLSFMRKEDFAEWLLFFTNTENKDIYWKNVREKLSAGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQELSNNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQHQSIQEYWKCVKKESIKGVKEVWKQAGKGLF

Micu2

Calcium uptake protein 2, mitochondrial

432 amino acids

Key regulator of mitochondrial calcium uniporter (MCU) required to limit calcium uptake by MCU when cytoplasmic calcium is low (PubMed:23409044, PubMed:24560927). MICU1 and MICU2 form a disulfide-linked heterodimer that stimulate and inhibit MCU activity, depending on the concentration of calcium (PubMed:24560927). MICU2 acts as a gatekeeper of MCU that senses calcium level via its EF-hand domains: prevents channel opening at resting Ca(2+), avoiding energy dissipation and cell-death triggering (PubMed:24560927).

Belongs to the MICU1 family. MICU2 subfamily.

49.476 kDa

MAAAAGRSAWLAAWGGRLRRGLAAGRRAVPTRGPLAAAVAGVALAGAGAAWHHGRVKAAAREGSRTVSAQKNYLGPIEKLSLRKQRFMQFSSLEHDGEYYMTPRDFLFSVMFEQVERKTLVKKLAKKDIEDVLSGIQTARCGSTFFRDLGDKGVISYTEYLFLLTILTKPHSGFHVAFKMLDVDGNEMIERKEFVKLQKIISKQDGFKTVKTNETEYQDPTVKEPGVNTTLQVRFFGKRGEKKLHYKEFRRFMENLQTEVQEMEFLQFSKGLNFMRKEDFAEWLLFFTNTENKDIYWRNVREKLSVGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQELSDNLLDTVFKIFDLDGDECLSHGEFLGVLKNRMHRGLWVSQQQSVQEYWKCVKKESIKGVKEAWRQQAGKGPF

Micu2

Calcium uptake protein 2, mitochondrial

432 amino acids

Key regulator of mitochondrial calcium uniporter (MCU) required to limit calcium uptake by MCU when cytoplasmic calcium is low. MICU1 and MICU2 form a disulfide-linked heterodimer that stimulate and inhibit MCU activity, depending on the concentration of calcium. MICU2 acts as a gatekeeper of MCU that senses calcium level via its EF-hand domains: prevents channel opening at resting calcium, avoiding energy dissipation and cell-death triggering.

Belongs to the MICU1 family. MICU2 subfamily.

49.442 kDa

MAAAAGRSAWLAAWGGRLRRGLAAGRRAVPTRGPLAAAVAGVALAGAGAAWHHGRVKAAAREGSRTVSAQKNYLGPIEKLSLRKQRFMQFSSLEHDGEYYMTPRDFLFSVMFEQVERKTLVKKLAKKDIEDVLSGIQTARCGSTFFRDLGDKGVISYTEYLFLLTILTKPHSGFHVAFKMLDVDGNEMIERKEFVRLQKIISKQDGFKTVKTNETEYQDPTVKEPGVNTTLQVRFFGKRGEKKLHYKEFRRFVENLQTEVQEMEFLQFSKGLNFMRKEDFAEWLLFFTNTENKDIYWRNVREKLSVGESISLDEFKSFCHFTTHLEDFAIAMQTFSLAHRPVRLAEFKRAVKVATGQELSDNLLDTVFKIFDLDGDECLSHGEFLGVLKNRMHRGLWVSQQQSVQEYWKCVKKESIKGVKEAWRQQAGKGPF