MIC10

MICOS complex subunit MIC10

97 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic10 family.

10.408 kDa

MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV

mic10

MICOS complex subunit mic10

93 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic10 family.

9.979 kDa

MSDSTSSPVAAAPSTAMTRPVSEALLNEKWDRCLSNLLIKSTLGLGFGVVFSVLIFKRRAWPAFVGVGFGAGRAYEECNTSLKQAAREIRAQA

mic10

MICOS complex subunit mic10

86 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic10 family.

9.309 kDa

MSTSQSSEQTLNYQWDVCLSNMVVQSGIGLGAGIVSSVLFFRRAAWPVWGGLGFGLGKSYADSNARLRTFHAIPKQLPASSTQKKD

MIC10

MICOS complex subunit MIC10

82 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic10 family.

8.755 kDa

MSGQLEVSAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLGRGYAEGDAIFRSHAGLRAVRA