MHF2

Protein MHF2 homolog

104 amino acids

Acts in the same pathway as FANCM to restrain class II meiotic crossing over (CO), and acts with FANCM during meiosis to repair interstrand cross-links (ICLs).

Belongs to the CENP-X/MHF2 family.

11.681 kDa

MDANNTFDSDLIHAIFKHIWARRFRERERSDAIDATEAEVALGTTKKNRLASANANALKLSCELLKSFVSEAVQRAAIIAEAEGMEKIEATHLERILPQLLLDF

mhf2

Inner kinetochore subunit mhf2

89 amino acids

dsDNA-binding component of a FANCM-MHF complex involved in DNA damage repair and genome maintenance (PubMed:24026537). FANCM-MHF promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork (Probable) (PubMed:24026537). FANCM-MHF promotes non-crossover recombination both in mitotic and meiotic cells (PubMed:22723423, PubMed:24026537). Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly (PubMed:24026537).

Belongs to the CENP-X/MHF2 family.

10.051 kDa

MEQESELLSLNTLARILTLYFSSEKGTKITPSALELITQYLRIYSKEAVCRAYEEKKNSIMSSSENEDIVLELEDLENGIAAQLALDFS

MHF2

Inner kinetochore subunit MHF2

80 amino acids

DNA-binding component of a FANCM-MHF complex involved in DNA damage repair and genome maintenance (PubMed:20347428). FANCM-MHF promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork (By similarity). Component of the kinetochore, a multiprotein complex that assembles on centromeric DNA and attaches chromosomes to spindle microtubules, mediating chromosome segregation and sister chromatid segregation during meiosis and mitosis. Component of the inner kinetochore constitutive centromere-associated network (CCAN), which serves as a structural platform for outer kinetochore assembly (PubMed:22561346).

Belongs to the CENP-X/MHF2 family.

9.05 kDa

MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKSPLELSHQDLERIVGLLLMDM