MGMT

Methylated-DNA--protein-cysteine methyltransferase

216 amino acids

Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.

Belongs to the MGMT family.

23.052 kDa

MDKACKMRYKTMDSPLGKIEISGCAQGLHEIRLHDRKTPDPGPAEAPAPPELLGCPEEMTEPLVQCVAWLDAYFREPSVLPGLPLPAIHHPIFQRGSFTARVLRKLLELVKFGDTVSYQQLAALAGNPKAARAVGGAMRSNPVPILIPCHRVVCSSGAMGNYTGGLATKEWLLAHEGRLAGKPTYPGGSYLAGTRRGALGGTPSPHPAGRDGCVRE

Mgmt

Methylated-DNA--protein-cysteine methyltransferase

211 amino acids

Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.

Belongs to the MGMT family.

22.435 kDa

MAETCKMKYSVLDSPLGKMELSGCERGLHGIRLLSGKTPNTDPTEAPATPEVLGGPEGVPEPLVQCTAWLEAYFREPAATEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGETVSYQQLAALAGNPKAARAVGGAMRSNPVPILIPCHRVVRSDGAIGHYSGGGQAVKEWLLAHEGIPTGQPASKGLGLTGTWLKSSFESTSSEPSGRN

MGMT

Methylated-DNA--protein-cysteine methyltransferase

209 amino acids

Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.

Belongs to the MGMT family.

22.333 kDa

MAETCKMKYTVFHSPLGKIELCGCERGLHGIRFLSGKTPSSDPKEAPASPELLGGPEDLPESLVQCTTWLEAYFQEPAATEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGEMVSYQQLAALAGNPKAARAVGGAMRNNPVPILIPCHRVICSNGSIGNYSGGGQAVKEWLLAHEGIPTRQPACKDLGLTGTRLKPSGGSTSSKLSG

Mgmt

Methylated-DNA--protein-cysteine methyltransferase

209 amino acids

Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.

Belongs to the MGMT family.

22.244 kDa

MAEICKMKYTVLDSPLGKIELSGCERGLHGIRFLSGKTPNTDPTEAPACPEVLGGPEGVPEPLVQCTAWLEAYFHEPAATEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGEMVSYQQLAALAGNPKAARAVGGAMRSNPVPILIPCHRVIRSDGAIGNYSGGGQTVKEWLLAHEGIPTGQPASKGLGLIGSWLKPSFESSSPKPSG

MGMT

Methylated-DNA--protein-cysteine methyltransferase

207 amino acids

Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.

Belongs to the MGMT family.

21.646 kDa

MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

MGMT

Probable methylated-DNA--protein-cysteine methyltransferase

149 amino acids

Belongs to the MGMT family.

16.851 kDa

MKIEIIETKIGLVKIIYDDTQTKIISVMFIDSSKIKPVKNSLSGLHKYFKGQNDYFTNLDLELKGTPFQRKVWKQILEIPFGETRTYSDIAMAIGNPKAVRAVANACGANPIAIIVPCHRVVGKNNDGGYEYGLEKKLWLLDFEKKNTQ

MGMT

Methylated-DNA--protein-cysteine methyltransferase

9 amino acids

Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.

Belongs to the MGMT family.

0.967 kDa

single

NPIPILTPC