mgm101

Mitochondrial genome maintenance protein mgm101 homolog

377 amino acids

Performs an essential function in the repair of oxidatively damaged mtDNA that is required for the maintenance of the mitochondrial genome. Binds to DNA (By similarity).

Belongs to the MGM101 family.

42.622 kDa

MKRFISTTSLRVLSNLNKNNNNNNKFNKSIVGVFNREFSSSNEGLNKVNFGENNNSSTTEPTKVLFNDSQFYQEDKYQGISKEPFSKEIVDTLLADLNPDDIEIKPDGLIYLPEIKYRRILNQAFGPGGWALKPFGPPVVEGKTLIRPYALYCLGRYVAESIGEQQYVPNSFISFATATESAKSNALVRCCKDLGIGSSLWDPIFIRQWKSEYATERWCENSKTKERRLFWFLSNRSENQLPYPWKESDFNQVPSNSSYSSSSSSINNNSNSSNNNNNNSDSSSSINQPQQETISYHQDDSSSPSSKITEQQDDSEDIDIDDVVPPQLKKYAGKTWRQLVADPKGLSYLQWASSSFDNAPKIKSQATAILEFINKSQ

MGM101

Mitochondrial genome maintenance protein MGM101

331 amino acids

Performs an essential function in the repair of oxidatively damaged mtDNA that is required for the maintenance of the mitochondrial genome. Binds to DNA (By similarity).

Belongs to the MGM101 family.

35.689 kDa

MRTMLTCVARSALRQTSMSAPARACFSASAPALSSRSRNYSKQQQQQPVARTGLKDLHPLPESMREQLESSDTPQEPYTASGNSNDPAVHSSRPASQPAEPEVSPRVAAPGLVNGSSSKNGSPSSASSNGASSSGASSSGTYSSGNASIPISNISEAWGTSFAGLGERSFSKEAIDVLMAPINEADVEIKPDGLIYLPEIKYRRILNKAFGPGGWGMAPRSETNVGQGIVSREWVLICQGRFVATARGEQEFFKPSGVPTASEGAKSNALMRCCKDLGVSSELWDPRFIRQFRKKHCIEVWAQDTAGKKKKLWRRKDDPPFEYPWKETGTA

MGM101

Mitochondrial genome maintenance protein MGM101

289 amino acids

Performs an essential function in the repair of oxidatively damaged mtDNA that is required for the maintenance of the mitochondrial genome. Binds to DNA (By similarity).

Belongs to the MGM101 family.

31.361 kDa

MRPTVALVVARGVRAMGYRTAAAATKPAAASATSAPATPAKKPAASSYWRKAASAASTASVSNATKKTPVAASSPAAEPIEADDMPQVDTSTVDQAPTFQYPEGAQSNVFQHMNQREIDWEQSFQGLGSQAFSKEAAQVLQAPLTVEDIEITPDGLLYLPEIKYRRVLNAAFGPGGWGLAPRSDTVVTDKIVTREYGLICEGRLVSVARGEQTYFNEDGVPTASEGCKSNAMMRCCKDLGVASELWEPKFIRKFKAQHCEEVWGTHVVNKRKKKLWKLKGETLAYPYQE

MGM101

Mitochondrial genome maintenance protein MGM101

275 amino acids

Performs an essential function in the repair of oxidatively damaged mtDNA that is required for the maintenance of the mitochondrial genome. Binds to DNA (By similarity).

Belongs to the MGM101 family.

30.744 kDa

MFNLIRLGFPRTSIIRYYSSTAVNQAKVYSRTYKRAGPVTKSSTSTSRSTSTDASPASSSPPKESVSDIEPSSEVPVKSTTSYILHDAPLEASNKNNGETINWSDSFHGLGAQPFSKEIAEILLAPVAEEDIEIKPDGLLYLPEIKYRRVLNRAFGPGGWGLAPRTESLVTSGQISREYGLICHGRLVSIARGEQDYFGGEEKLTTALEGCKSNALMRCCKDLGIASELWDPSFIRRWKKKYCEEIFVEHVNTKKKKKIWKLKSIKTIDYPYKMT

MGM101

Mitochondrial genome maintenance protein MGM101

275 amino acids

Performs an essential function in the repair of oxidatively damaged mtDNA that is required for the maintenance of the mitochondrial genome. Binds to DNA (By similarity).

Belongs to the MGM101 family.

30.627 kDa

MIRGTSLSTSSRSIKVFIFNARYSSNYVKAPIKKMSYNSAFQKSYYSNPASKNGMTNNSATTSSPKPISNNESESSSSSSTIKSFSDSPAIASSPEVGSPINWSDSFHGLGTAPFPKEVSDILLASIDNDDIEIKPDGLLYLPEIKYRRILNRAFGPGGWGLAPRTESLITPKQISREYALICHGRLVSVARGEQDYFGGDEKITTALEGCKSNALMRCCKDLGIASELWDPSFIRKWKKDFCDEIFAEHVTTKKKKKLWKLKKNKTLDYPYKKI

mgm101

Mitochondrial genome maintenance protein mgm101

270 amino acids

Performs an essential function in the repair of oxidatively damaged mtDNA that is required for the maintenance of the mitochondrial genome. Binds to DNA (By similarity).

Belongs to the MGM101 family.

31.179 kDa

MQTMLGKPALQYFGKLSRYLYKNGEPINIWVYSRNSSFSVIPKNGLLSPKITQRFYQNSSIQYQKDKNIYEPKENLEEKELSEGFLDESRLEIPEAGHNWEKSFFGLSSQPFSKEICDLLTAPLEVDDIEIKPDGILYLPEIKYRRILNKAFGPGGWGLAPRGNTNVTSKSVSREYALVCHGRLVSVARGEQTYFDPEGIATASEGCKSNALMRCCKDLGVASELWDPRYIRVFKRENCVEVFVENVLTKKRRKLWRRKEDKFSYPYKEV

MGM101

Mitochondrial genome maintenance protein MGM101

269 amino acids

Performs an essential function in the repair of oxidatively damaged mtDNA that is required for the maintenance of the mitochondrial genome. Binds to DNA.

Belongs to the MGM101 family.

30.091 kDa

MKSIFKVRGCVSHAAQFCQKRTVVSTGTSNTATAGAVRKSFNSTETKPVFATKSEAGNGSHMKEYSSGINSKLGGTPLETRSTADDSLNNSYKQVKGDIDWYTSWYGLGMKPFEAKVQKDLIEPLDPKDIEIKPDGLIYLPEIKYRRILNKAFGAGGWGLVPRSQTIVTSKLVTREYGLICHGQLISVARGEQDYFNEAGIPTATEGCKSNALMRCCKDLGVGSELWDPVFIKKFKVDHCTEKFVEHVTTKRKKKIWLRKDRQVEYPYK

MGM101

Mitochondrial genome maintenance protein MGM101

266 amino acids

Plays a role in the replication of the mitochondrial genome and the maintenance of its telomeres (PubMed:26743001). Able to catalyze strand annealing and D-loop formation (PubMed:26743001). Binds a wide variety of DNA substrates (PubMed:26743001). Exhibited the highest affinity for DNA molecules carrying 3' ssDNA overhangs (Y-form, 3' FLAP, 3' overhang) and for substrates with complex structures (X-O and Fork) (PubMed:26743001). Forms homogeneous ring-shaped structures at the ssDNA native telomeres ends (PubMed:26743001). Oligomers seem to bind to the ssDNA as a filament until they reach the double-stranded region and induce the formation of bends and loops within the double-stranded part of the molecules (PubMed:26743001).

Belongs to the MGM101 family.

29.989 kDa

MLHSTKLVFRATPQALCFPVRSYSRYVRTVPKTASAKTTSKLAPSITTEDEVAEQDPSLQEPQSATSTASFAFHDAPPETRSVLNSSTNNNIDWSDSYHGLGSQPFSREIADILLAPIKDQDIEIKPDGLLYLPEIKYRRILNKAFGPGGWGLVPRTESLITKSQISREYGLICHGRLISIARGEQDYFGGEEKVTTALEGCKSNALMRCCKDLGIASELWDPGFIRKWKAKYCEEVFVEHVVNKKKKKLWKLKSNKKIEYPYKQL

MGM101

Mitochondrial genome maintenance protein MGM101

262 amino acids

Performs an essential function in the repair of oxidatively damaged mtDNA that is required for the maintenance of the mitochondrial genome. Binds to DNA (By similarity).

Belongs to the MGM101 family.

29 kDa

MLGFRHVIRATSKRFATSGTSMVRKTVTSGNSNAIRSATSNVVPPASSAAAASAPSTIKRVPGYNKTLEDSLNGTILENPVETQATQSSNEINWYTSYHGIGSKPFSDETQNALSSALNADDIEIKPDGLIYLPEIKYRRILNKAFGPGGWGLVPRSETIVTAKLVTREYALVCHGQMVSIARGEQDYFSETGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIKQYKKKHCTEKFVEHVTTKKKKKIWLRKDREVEYPYK

MGM101

Mitochondrial genome maintenance protein MGM101

254 amino acids

Performs an essential function in the repair of oxidatively damaged mtDNA that is required for the maintenance of the mitochondrial genome. Binds to DNA (By similarity).

Belongs to the MGM101 family.

28.003 kDa

MIRFCSARLIQRGLHTAVAKPVMATSTAASRAAASKMAGAQAETGVVGSRLVPGYGRTLTRALGGQVLEADTEGGGHVMTEGSVDWRRSFHGLGAKPFAAPVQEELARALEPLDIEIKPDGLLYLPEIKYRRILNRAFGAGGWGLAPRSDTIVTAKLVTREYALVCHGQLVSVARGEQDYFIDTGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIKKFKKEYCMERFVEHLTTKKKKKIWLRKDREVEYPYK

MGM101

Mitochondrial genome maintenance protein MGM101

244 amino acids

Performs an essential function in the repair of oxidatively damaged mtDNA that is required for the maintenance of the mitochondrial genome. Binds to DNA (By similarity).

Belongs to the MGM101 family.

27.144 kDa

MQRLLKFSGHGSRALFLARRWNSNIASGTAGTFQTTAKPLRSVKPTEAALALNGKFLESTNGNENGITSMGSIDWYTSWHGLGSKPFDATVQKALALPLEPTDIEIKPDGLIYLPEIKYRRILNRAFGAGGWGLVPRSQTIVTSKLVTREYGLVCHGQLVSVSRGEQDYFSETGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIKRFKTEHCVEKFVTHIATSKKKKIWIRKDRSVEYPYKA