MFT

Protein MOTHER of FT and TFL1

173 amino acids

May form complexes with phosphorylated ligands by interfering with kinases and their effectors (By similarity). Regulates seed germination via the abscisic acid (ABA) and gibberellic acid (GA)signaling pathways. During seed germination, MFT expression is directly repressed by ABI3 or promoted by ABI5 in the ABA signaling pathway. Involved in a negative feedback regulation of ABA signaling. Promotes embryo growth by direct repression of ABI5. In the GA signaling pathway, MFT expression is promoted by the DELLA protein RGL2 during seed germination (PubMed:20551347). May regulate seed germination and fertility through the brassinosteroid (BR) signaling pathway (PubMed:20935478).

Belongs to the phosphatidylethanolamine-binding protein family.

19.134 kDa

MAASVDPLVVGRVIGDVLDMFIPTANMSVYFGPKHITNGCEIKPSTAVNPPKVNISGHSDELYTLVMTDPDAPSPSEPNMREWVHWIVVDIPGGTNPSRGKEILPYMEPRPPVGIHRYILVLFRQNSPVGLMVQQPPSRANFSTRMFAGHFDLGLPVATVYFNAQKEPASRRR