MFF

Mitochondrial fission factor

342 amino acids

Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface. May be involved in regulation of synaptic vesicle membrane dynamics by recruitment of DNM1L to clathrin-containing vesicles.

Belongs to the Tango11 family.

38.465 kDa

MSKGTSSDTSLGRVSRAAFPSPTAAEMAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLWHRSDSAPRNKISRFQAPISAPEYTVTPSPQQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR

Mff

Mitochondrial fission factor

291 amino acids

Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface. May be involved in regulation of synaptic vesicle membrane dynamics by recruitment of DNM1L to clathrin-containing vesicles.

Belongs to the Tango11 family.

32.931 kDa

MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQEFQDGVPNASVIMQVPERIVVTGNNEDISFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPLPTPQSEESRAVGRLKRERSMSENAVRQNGQLVRNDSIVTPSPPQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNLDAAIEGASDDMTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR

MFF

Mitochondrial fission factor

218 amino acids

Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface. May be involved in regulation of synaptic vesicle membrane dynamics by recruitment of DNM1L to clathrin-containing vesicles (By similarity).

Belongs to the Tango11 family.

25.06 kDa

MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVSNASVIMQVPERIVVAGNNEDIPFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPAPTPQNEEIRAVGRLKRERSMSENAVRQNGQLVKTDSMYGISNIDAMIEGTSEDMTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR

MFF

Mitochondrial fission factor

218 amino acids

Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface. May be involved in regulation of synaptic vesicle membrane dynamics by recruitment of DNM1L to clathrin-containing vesicles.

Belongs to the Tango11 family.

25.031 kDa

MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKSLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRVKRERSMSENAVRQNGQLVRNDSLYGISNIDTTTEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR

Mff

Mitochondrial fission factor

218 amino acids

Plays a role in mitochondrial and peroxisomal fission. Promotes the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface. May be involved in regulation of synaptic vesicle membrane dynamics by recruitment of DNM1L to clathrin-containing vesicles.

Belongs to the Tango11 family.

24.971 kDa

MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQDGVPNASVIMQVPERIVVTGNNEDISFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPPTPQSEEIRAVGRLKRERSMSENAVRQNGQLVRNDSMYGISSLDAAVEGASEDMSVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR