About Products Protein Database Contact

METK5

Gene
METK5
Protein
S-adenosylmethionine synthase 5
Organism
Populus trichocarpa
Length
395 amino acids
Function
Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.
Similarity
Belongs to the AdoMet synthase family.
Mass
43.174 kDa
Sequence
MAETFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRNIGFTSADVGLDADNCKVLVNIEQQSSDIAQGVHGHFSKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILQIVKESFDFRPGMISINLDLKRGGNSRFLKTAAYGHFGRDDPDFTWEVVKPLKWDNKVQA

Gene
METK5
Protein
S-adenosylmethionine synthase 5
Organism
Vitis vinifera
Length
391 amino acids
Function
Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.
Similarity
Belongs to the AdoMet synthase family.
Mass
42.793 kDa
Sequence
METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADIDYEKIVRDTCRTIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCSWLRPDGKTQVTVEYHNENGAMVPLRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMIAINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKA