MED8

Mediator of RNA polymerase II transcription subunit 8

524 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Regulator of both plant defense and flowering time. Involved in pollen tube growth.

Belongs to the Mediator complex subunit 8 family.

58.157 kDa

METQPQQPPPPPVAEKLNPKLEKELNLESLKTRAVSLAKAIARILEDFDAYGRTNTTPKWQDILGQYSMVNLELFNIVEEVKRVSNAFVVLPKNVNAMNAAILPVMLSSKLLPEMETDDNAKREQLLQGVQSLPIPMQIERLKARMDMIAAACENAERVLADTRKAYGFGTRQGPSMLPTMDKGQAAKIQEQEKMLRDAVNDGKGTQLPPDQRQITTALPPHLADVLIINDAGKIALPGQSNNINNQGMMQVSGTQFVGRSAASPSGPNFDNTTSPLPYSNSPRATGMVNVPSPQHQIQQQQFQQQQQRSKLMQLPQHQQQQLLAQQQQQLRQSSMQGLGQSQIPALHDMHGQAQQKFQTSHGQHQMPYSQPMGAHQQFQARQLSGGHIQHSMSQGQLNPAMNRHLNQFSGGANSALFTSAQGSPSSQMIPNMSSMQSQTLVPRMQQFGVSGTNPQRSHSSQMLGDQMFNTSGMMQTQQTQIQQSQQQQQQQQQGGYGNMQTNQQSLQPNNMMQNAQQRHQNPQ

med8

Putative mediator of RNA polymerase II transcription subunit 8

524 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May play a role as a target recruitment subunit in E3 ubiquitin-protein ligase complexes and thus in ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).

Belongs to the Mediator complex subunit 8 family.

58.691 kDa

MNGVDINSNLDSIKAKAEDIRNLLLTTSTGNWEDILGHFVVLSGEYGSLVREVNNIYDSVAVFPEQVTGDPNLIPNLLRTKLSPELETKNRDIINQYVSKNSTHYDPGNQEENIPPLKLHIKSFNDRIDKVDQEFENKIQQISKHKLTKPSASHDTAILKDILSITMLGSGIKINAQQQLAQQQQQQATINALQQQQRLLNAQQQQQQQQQPQALYKLPATNTANTSTNTPSSTIVINSPSPGGIHHNVPTPPTNLNAAGTRTSPPNVQQYVNSPPPQQQQQQQINTVIGTPNTIPTTPTATVSTAATYKPVASPQQQVTSKQVPIQSTNKPLPQQQPSIQIQPQQSIVQMVQNVLPNTTSPPVNNNNQSPINSGIGGGQFKPSAINIANANSGTSTIQQQIQLQQQQLQQQIQLQQQLAQQQQQNQQNQQNQQNQQNQQNQQIHQHIQHLTPQQQAQLQQQMLQQQQLQQQFQQQQLSQQLLQQQQLHQQQQPNQTIQNPFHNFQANNFRVQNPTNFNPPQNQ

MED8

Mediator of RNA polymerase II transcription subunit 8

288 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

31.56 kDa

MSPEELKQLELLRNRFAQLTSNLGSLRTSVSNSNPLPTYESLQASVNILQANIRSIQDIATENAGLFQRLAIHPSTNFPGRTQEHILTQLLRKKLEPNVESWVEEARATARGVGVDASKLAGGVHRRGEHDYDDEGTYGMDEDGDDAPQDPFSEQWADMLDNFQQTLQQYVTVQVKKKYTAEERAAGIENVRTGLRQTLEESEDDDEDEEEEEEDEEEDEAAAAAGNAGGLATGAGGSAAAGGGMFGAIEPEHIFYLQAQGNLQLPGNVPIESKRIQTVPTRRVAPPR

med8

Mediator of RNA polymerase II transcription subunit 8

269 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

28.874 kDa

MSSLNQDQIKTLEQSRQRLIQLTHSLASLITSLNQSDPLPSWTSLQSQATIISNNLLTISDHLSDNRDLLSNIVAYPDASYPSRVPANNVALEQVLRTKLDPRVEDWVARGRRAGAPTTSSDAGAGALGQYQTSSGQRLLSDDAIAELWDWAPVAANEEARKRNWGGNYTLEEREMGIENVVTGLSRVLEDDDEEDESDSEEGEGEADEMEVVGARRRSGAGAGLEFDIAAANTGSGANAGAGAKVVAPVVPLDEILRFMTTGAVPGQR

MED8

Mediator of RNA polymerase II transcription subunit 8

268 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May play a role as a target recruitment subunit in E3 ubiquitin-protein ligase complexes and thus in ubiquitination and subsequent proteasomal degradation of target proteins.

Belongs to the Mediator complex subunit 8 family.

29.08 kDa

MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFALLSGQLNTLNKVLKHEKTPLFRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCSNLLEKISKEERESESGGLRPNKQTFNPTDTNALVAAVAFGKGLSNWRPSGSSGPGQAGQPGAGTILAGTSGLQQVQMAGAPSQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQR

Med8

Mediator of RNA polymerase II transcription subunit 8

268 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May play a role as a target recruitment subunit in E3 ubiquitin-protein ligase complexes and thus in ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).

Belongs to the Mediator complex subunit 8 family.

29.199 kDa

MQREEKQLEASLDALLNQVADLKNSLGSFIYKLENEYDRLTWPSVLDSFALLSGQLNTLNKVLKHEKTPLFRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCSNLLEKISKEERESESGGLRPNKQTFNPGDTNALVAAVAFGKGLSNWRPSGSSGPGQPGQPGAGTILAGASGLPQVQMPGAPNQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQR

med8

Mediator of RNA polymerase II transcription subunit 8

267 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May play a role as a target recruitment subunit in E3 ubiquitin-protein ligase complexes and thus in ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).

Belongs to the Mediator complex subunit 8 family.

29.402 kDa

MQQREEKQLEAFLESLVARVAHLKGSLQSFIYKLENEYDRLTWPSVLDNFALISGQLNTINKLLRNEKTPSYKSQVIIPLLLSPDRDEELAKLTEHRVPVFSHEIVPDHLRTKPDPEVEEQEKHLSAEAARIGPEVAQKQIQALNKLCSNLLEKLNNPREDRDSETSALRQNKPSFNPADTNALVAAVGFGKGLSKCRPPGPVAPGHPGQPMMQTGPTLQQVTIAGASGHQAGMSGPVAPQQPGQPGKIPSNIKTNIKSASMHPYNR

med8

Mediator of RNA polymerase II transcription subunit 8

267 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May play a role as a target recruitment subunit in E3 ubiquitin-protein ligase complexes and thus in ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).

Belongs to the Mediator complex subunit 8 family.

29.448 kDa

MQREEKQLEACLDALISQVSDIKNSLVGFIHKLENEYDRLTWPSVLDSFALLSGQLNTLNKVLKNEKTPLLRNQVIIPLLLSPDRDEEIMRLTEGRVPVFSHEVVPDHLRTKPDPDVEELEKQLSAEAARITSEAAQKQVQSMNKMCSNLLDKISKEERESELGSLRQNKQTFNPTDTNALVAAVAFGKGLSNRRPPGQGGPMAPGQTGASSMLPNATGMQVPMSLPPNQQQQHMAGVSMSQGSQPGKMPSSIKTNIKSASMHPYQR

MED8

Mediator of RNA polymerase II transcription subunit 8

262 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

29.206 kDa

MASLNQEQLKILEQTRQRLLHLTQSLGSLSNSINQSDPLPPWSSLQSQATIISNNLLSISHLLTEHQELLSSIVAYPTPNFPGRTESTILHQLMRTKLEPRVEEWVARGRNVARHNTASSQIRAQQGAAAEGETVRLSVDELLDLWHWAPIAANMEARRRDWGGDYTLEEKEMGVKNVITGLKRQLDEGDEEDEEEEEEEEDMQGEEMEVVVGAHTKAGGGSGVEFDIARGSSHIPSKPVAPGMPLDDIFRFMMTGAPPRPR

med8

Mediator of RNA polymerase II transcription subunit 8

260 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

28.045 kDa

MTTLSPDHLKTLEQSRQRLIQLTHSLGSLITSLNQSDPLPTWSSLQTQASIISNNLQSISTHLSENHELLRSISALPAPEFPTKTHANTLEQLLRTKLDPRVEDWVSRGRKADNSAIQGSSGSTGMFSTLPSASAAGMNAGVVGAGAGGRLSEDDLAALWEWAPVEANSEARRRNWGGNFTLEEKERGIQQVVAELGLKRVLEDDDESEEEDEEMDVGFGGRIDGAPDNAGAAAGEHALPLVPINEILRYMTTGVMPAVR

med8

Mediator of RNA polymerase II transcription subunit 8

254 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

28.132 kDa

MASPSQDQIKVLEQSRQRLVQLTRSLGSLIGSLNQSDPLPSWSSLQSQASIISNNLLSVSEHLSDNCDLLSALVAYPGPEYPGRTQASTLEQLLRTKLDPRIEDWVARGRRAGASALEDKDALSETELAELWDWAPVEANQEARRRNWGGDYTLEEREMGIQNVVTGLRRQLEDDERDEDEDEDDEEEEEGEGEDEEMEVVGVRRRSDAGAGLGFDTAVPTPASSQQVQKGAGPVVPLDDVLRFMTTGTLPQQR

MED8

Mediator of RNA polymerase II transcription subunit 8

252 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). Required for activated transcription of the MtnA and MtnB genes.

Belongs to the Mediator complex subunit 8 family.

27.948 kDa

MQRDEKLFELTLDTVLQRLNDLKLAVLSMIQKLELEYETINWPTFLDNFAIISSHLTGLTKILAKEQCPPLRNRTVLPLLVSMDRDDTLINITEGRVPVFSHDIVPDYLRTRPDPITEQKMLQNEQKAANLTNDAAMKQVTQYNKVVSHVLDMVSKAREEWEIESSSRTGIQQTSSMADTQLLVAAVGMGKGLKLTNYGPGPGMMVPPSIRAPSPMGGPAMSPGNVQQQLGKAPSAVKTNIKSANQVHPFSR

med8

Mediator of RNA polymerase II transcription subunit 8

252 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

27.804 kDa

MASLNQDQIKTLEQSRQRLVQLTRSLASLIGSLNQSDPLPSWSSLQSQAGIISNNLLSISEHLSDNKDLLSALVAYPGPSYPGRTQAPTLEQLLRTKLDPRVEDWVSRGRRAGASALEDRGALSESALAELWDWAPVEANQEARRRNWGGNFTLEEREMGIQNVVTGLRRQLEDEDEEESESESEEEGEGEEEEMEVVGVRRRSGAGAGLEFDIAAPTPGSRQQQQQKAAGPAVPLEDILRYMTTGIPPTQR

MED8

Mediator of RNA polymerase II transcription subunit 8

250 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

27.09 kDa

MQREEKQMDMLLEAVLNRLNDLKHSIGAMIHRLETEYETINWPTFLDNFALISGHLTGLSKILSSEIGTPLRNLTVLPLLLTPERDEALLQLTEGRIPIFSHDLVPDYLRTKPDPGAESRMAAHEAKANNLQPDTAAKQVAQYNKVISHVWDIVSKAREEWDTEASSRPGIQQTSSLADTQALVAAVGVGNGLTMPVGPGGVPNAGIMIPPAIRQASPMSAVSPGAGPLGKMPSGIKTNIKSANQVHPYR

MED8

Mediator of RNA polymerase II transcription subunit 8

249 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

27.162 kDa

MQREEKQLDMLLEAVLNRLNDLKHSIGVMIHRLETEYETINWPTFLDNFALISSHLTGLMKILSTEIGTPLRNLTVLPLMLTPERDEALLQLTEGRVPIFSHDLAPDYLRTKPDPGAESRQAAHEAKANNLTVEASMKQVAQYNKVISHVWDIISKAKEDWENESSTRPGIQQTSSMADTQALVAAVGLGNGLTAPVGPPTGAGVMIPPAIRQGSPMSAVSPSGNAPMGKMPSGIKTNIKSANQVHPYR

med8

Mediator of RNA polymerase II transcription subunit 8

249 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

27.465 kDa

MASLNQDQIKILEQSRQRLVQLTRSLASLIGSLNQSDPLPSWSSLQSQAGIISNNLVSISEHLADNKDLLSALVAYPGPSYPGRTQAPTLEQLLRTKLDPRVEDWVSRGRRAGASALEDRGALSESALAELWDWAPVEANQEARRRNWGGNFTLEEREMGIQNVVTGLRRQLEDEDEEASESEEEVEEEEMEVVGVRRRSGAGAGLEFDIAAPAPGSRQQQQQQKAAGPAVPLEDILRYMTTGIPPTQR

med8

Mediator of RNA polymerase II transcription subunit 8

244 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

26.985 kDa

MATPTQEQLKTLEQSRQRLVQLTRSLASLITSLNQSDPLPSWSSLQSQASIISNNLLSVSDHLSDNRDLLTSLVAYPGPDYPGRTQANTLEQLLRTKLDPRVEDWVARGRKAGASALEDKSGLAEAELAELWDWAPVEANQEARRRNWGGNFTLEEREMGVQNVVTGLARVLEDEGSESEDEEEGEEDEMEIVGVRRQSAGAGFEFDIAPASAAQHQQQKFVEPAVPLEDILRFMTTGAEPGKR

MED8

Mediator of RNA polymerase II transcription subunit 8

239 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

27.959 kDa

MSQTPFNPNSPSVPTTTSLPSTDFSQIPYDVLESIRNRLNQIRQSLTKLADQINNHNRHPQKIKLPSYSYFQNQFQVLITQLMSITNQLYNNEDLLRNTNVYPTPIFPTSAHENMLTTLLRKKVAPEVDEWINGAKLIMENETKNKLDNQQVEIDILKIDQWVQWCLAKIQDLRDEFQFYGFHTVEELDHMETPQGKQEIKEKKDKEFEREQIELKITAGGQKSLHPNQVLKFMCQGQI

MED8

Mediator of RNA polymerase II transcription subunit 8

233 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

26.177 kDa

MSGINGALVEDIKPDYSGVPGPALDSVRMRLAQLTHSLRRIRDDLSRADLTQWYSLQSQINVTLSQLMSVTSTLQHFEDTLDSTIVYPLPKFPTTSHESLLTTLLRKKNIPEVEEWIKDAIEASGVDTNMMRDDEIEKILEKNNEDSKWALEVFAKEFEKRESNGDTADDLDVLGNALKPVKTSVRQRAQSPFQVEDVLKYMSRGEVDRGSSSQEGLSTNNEQSGDKDIIMAD

MED8

Mediator of RNA polymerase II transcription subunit 8

225 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

26.203 kDa

MNSIHSANSNTVSTSEINTSQIPTDSLESIRNRLNQVHLSLRKLSDQINHHNRHPNKVKLPNYAQFQNQFQVLLTQLHTITSDLENNDELLKNTNVYPLPSFPTTQQEGLITTLLRKKPLPEVDEWIESAIDKRKNEYVNVQKDDEFAQWCLTKIEELREDFQFYGFNSVEELKYLDSEDEKKETEENKKIENQKYEEELKITAGGKSGLHPNRVLKFMCQGVLT

MED8

Mediator of RNA polymerase II transcription subunit 8

223 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

25.088 kDa

MSQTSPLSEQADSSLKYDYSNVPAQALDAIRMRLAQLTHSLSKIRDDMSKADLPQWYSLQAQLSVTLTQLSSLTSTLQHFEDTLECTVPYPLPSFPTTAHEGLLTTLMRKKQIPEVENWIKDAIDHSGLDLEGRNWDEIESAIQRDKSTTARALDFINQEYSNYSFQGLYTAEELSKNVGDPQSMIYRSATSNAKPKAPFSVDSILTFMYQGTMKTEETSIAK

MED8

Mediator of RNA polymerase II transcription subunit 8

223 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. The Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins. MED8 binds to the consensus sequence 5'-[AC][AG]GAAAT-3' in both the UAS of SUC2 and the DRS2 of HXK2.

Belongs to the Mediator complex subunit 8 family.

25.268 kDa

MSQSTASLVPEGNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFKNEESLSEEHASLLVRDSKPSKPFNVDDVLKFTFTGEKPIITGSTSTSSSN

MED8

Mediator of RNA polymerase II transcription subunit 8

215 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

24.176 kDa

MTDTPSNTDPLQSAIAPDFSSVPTQALDALRMKFSQLTASLSKIRDEMSRAELPQWYTLQAQLTVTLSQLSSLTNTLDHYEETLDATVAYPLPSFPTTAHEGLITTLMRKKNIPEVDEWIKDAKETNGLDVDSLSDAEIKKLINKDKDITSWATKCLLDERAKHSYTGLYTTKERQTESIDDRDNLYTSSVSNVKTSRPFSVDKVLKFVNQGESY

med8

Mediator of RNA polymerase II transcription subunit 8

200 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 8 family.

23.333 kDa

MEDISTEKTVESLEAIRHRIAQIVQSLTHFLAILHQSESLSPWPTIHKNFNILLSQIHSLSNNLAAHSHTLQTTSIYPSLEFPVKEQEPLLTTLLRTKALPEVEEWEANTLQEYEASISSQPKKKEANDAYQKDQLWDQARIIFMEERENYSWFDFVTRRQESEGEFVSQRQLEIDRATEEQNANQMLTDILSFMKSGKR

MED8

Mediator of RNA polymerase II transcription subunit 8

194 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 8 family.

21.744 kDa

MNQPIEPDHINVPTEALESLRLRLTQVSHSLNTLQAQLHQPTLPPWSSLHNQFNVLLTQLVSLSSTITHQSDILQQTVTFPLPAFPTATEAGLMATLLRKKILPEVEEWCEEVKQKALGVKIRTVDQYGEWAAETVEEAKQEYEWYGLMTREEVDNGVKPPVYVAPEEEAGEGAKLTIEQILQFTCAGKMPTVA