MED30

Mediator of RNA polymerase II transcription subunit 30

325 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 30 family.

36.309 kDa

MWKYGQNQGNQGPAGGGGGAPNMMPMGGFMQGGGGMQGGGGMQHGNMPQMHMTPQQQQQQQQMNMMGGPGGMQMNPNAVGPTGLMPGMSPQHQMQQQQQMMQGVPMSMPPQQAMQQQMMGPQQGLGMGGSSGPQQQQQLQQQQQQSNLQQQQQQHNVGSGGAPGAGGVGNNMLAISQPNPHKEINIVQLSRLGQETVQDIASRFQEVFSALKNIQPTSHRDNNTEKKVQEYFRTIRLLFKRVRIIYDKCNDAVMDYMNAESLIPYKDEPEPRIETSQCDEYRKVLQENHEYIETVKLKNRQLREIIDRTRIIIWEINTMLAMRRS

MED30

Mediator of RNA polymerase II transcription subunit 30

318 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 30 family.

35.301 kDa

MWKYGQNQGNQGPSSGGGGGGGPNMMPMGGFGMQHGNMQQMHMSPQHQQQQQQMGMMGGPGSMQMNPQGPGGPGGLMPGMSPQHQMQQQQQQQMMQQQMMVPQQGVGVGVGMGGGVGMGGGGVVPQQQQQQPQQNMPQQNIPQQQQQLNPVAGIPPGGAGGSNNMLAISQQNPHKEINIVQLSRLGQETVQDIASRFQEVFASLKGIQPTSHRENSSEKKVQEYFRTIRLLFKRVRIIYEKCNDAGMDYMSAESLIPYRDEPEPRIEPSLCDEYRKVLQENHELIETVKLKNRQLREIIDRTRIIIWEINTMLAMRRS

MED30

Mediator of RNA polymerase II transcription subunit 30

306 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 30 family.

33.622 kDa

MSGQYPSGYQSPSGHRGNFNSPMMQQQLNQMGVPNQMGMMGFNQGNVMQNQQQMQSGGVQSGPDIGMGQNIQQQQQPNPSQGTGQGQQQQPGQGQAQGQQQQNPQQSPQLGMAAGGQAVSSAAQSATGTVGGAPPGQPNAGPVASTQAASNVQQKEFNLLTLCRIGQETVQDIVSRFQEVFGLLRGIQPPNGTNAGLSSSNDKKAKVQEQFRTIRLLFKRLRLLYDKCNDNCQQGMEYTHVESLIPLKGEPERAEPIHTEEYKKALQENRELIEIVMLKNKQLREIIDKIRLTIWEINTMLSMRRC

med30

Putative mediator of RNA polymerase II transcription subunit 30

255 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 30 family. Highly divergent.

28.143 kDa

MDKIEIEEELICSLAVKGEKSIHKLLLNILAIVKQLKTIQSDPVLTYQVSTKAQQQLQSQQLQQPQSIPSSTNNSTNTNTNNSTTTTTTSSTSSTTTPTTTTSTTSPLNSKDSTATTTTKEQPSSPTLPTLNLNFVNDNDKIKELNQNCIQSILALQKTIKEISLLETKISQKPKDNIDNDDTIMKDDNNNSSTSAPTTTTINIEKQDQTSLSNELERLKMDAYQKNCVIKKLIDNMRLLQLSINSMNRTSTGTD

MED30

Mediator of RNA polymerase II transcription subunit 30

193 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 30 family.

21.691 kDa

MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKDDRAGPPRFASEERREIAEVNKFQVNSKGTQPYLHMYPFSSKLPSHSGCRIPLSRIPCAVQNSNRRINS

MED30

Mediator of RNA polymerase II transcription subunit 30

189 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the plant Mediator complex subunit 30 family.

19.814 kDa

MLQKQVSTTTTMTTQELAMEGEKQLEETIEAAFQIISAMNDELCNPSLWSTSATPSSAATTTGSNGSALVSADAAAIDGTSHHSESAGGGGGGGSGNSVLDEASLRYKNSVTSLRAVLAAIPNSQKAKASEMQNGLGSPESEDEIEKLEEQALSLRMEIAKKNVHVKELIDKLRELIADISTWQSPCSV

med30

Mediator of RNA polymerase II transcription subunit 30

184 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 30 family.

20.871 kDa

MSTPPLSGPGMGAAAGPGGFPGAQAATAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTVTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPIEQLIPYVEEEYSKHDDRGIASQLRFASEEKREILEVNKKLKQKNQQLKQIMDQLRNLIWDINSMLAMRN

MED30

Mediator of RNA polymerase II transcription subunit 30

178 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 30 family.

20.277 kDa

MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

Med30

Mediator of RNA polymerase II transcription subunit 30

178 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 30 family.

20.358 kDa

MSTPPLAPTGMASGPFGGPQAQQAAREVNTATLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVDEDGSKNDDRAGPPRFASEERREIVEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

med30

Mediator of RNA polymerase II transcription subunit 30

174 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 30 family.

20.201 kDa

MTTPPLAQFSGQQQQQTQAARDVNTASLCRIGQETVQDIVLRTMEIFQLLRNMQLPNGVTYHPNTHQDRLGKLQEHLRTLSVLFRKLRLVYDKCNENCAGLEPIPSEQLIPYVEDDSSKLEDRMANQLRAASEERREVLEVNKKLKQKNQQLKMIMDQLRNLIWEINSMLAVRS