med27

Putative mediator of RNA polymerase II transcription subunit 27

450 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 27 family.

51.864 kDa

MQVQQPQQIQQQHLQQQQAQQHQQQQVQQHQQQQQQQQQQQQIYQQIVNQPVNNVHQLPSLQQQQLLEQYDELLKQVSLIRSNVSDFFNSFIEDAKQQQTIVNKEEMKQKLKKSMDLVLGSISSIDKVSKRISSYSFQIASSNFSTQEASWAYSTGIYDNRNIKVQLEIRNENYWRSQTSYKSSLASSNLENKLKDLFPIIFQEDEESSSLSKKRKQISSLTSNSLSTTTITTTTTPSPLFKLPSTPPTLLLSGTISPFYDYFAQIERVIHSIRQESALEIFEIQKQSSGAPKGLFVECPDVFKCLICFGIPNDRKDCFTIDRISFFGVKENFDSLWASSKYNIFKKISENSFEAISYYSANPNGGSILKCILSWIWSFRGLFLEECKGCQDILHLDSPQYMYLPPSFRTFDNYTPYHPSCYQNHLLSCNSFSSSTSSSIQQSPFSPLNK

MED27

Mediator of RNA polymerase II transcription subunit 27

402 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 27 family.

44.511 kDa

MQTLHQSQLLQNPAEAANNQSESDAPPKQVAQAMERLNQAARVIADIRLGADRILEAMFVASQPRHTDMPLQLFLREDASMRQHLQDLRLIGKKLEESGVLTESLRSRSNSWGLHMPLVCPDGAVVAYAWKRQLAGQAGASAVDRTRLALKAFTDQKRRFFPHIDDGLKMEPSSKKHRASHLLLENGREEPVDYKTLPDIQSRLEKLVPSVKVSTYGRLNWLKRANSLPGSGSDDPTEASKPIFQSSSKLRSGLQTEVVDKIAVIELSFPSLFRAIVSLSPAGSVDPDAVAFFSPDEGGSYLHARGFSVYHVYKHITEHAATALQYFLGFGTGTALYSLLLWICSFESVFSKPCTKCGRLLAMDKKSALILPPLHRAYQELPLALNLDVCEAYHSSCSQDDT

MED27

Mediator of RNA polymerase II transcription subunit 27

311 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 27 family.

35.373 kDa

MADVLSVGVNLEAFAQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMTIHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ

med27

Mediator of RNA polymerase II transcription subunit 27

311 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). Required for the development of dopaminergic amacrine cells in the retina. May also negatively regulate the development of rod photoreceptor cells.

Belongs to the Mediator complex subunit 27 family.

35.672 kDa

MADVMNVGVNLEAFSQAINAIQALRSSVTRVFDFLKDGMKNKETLESREKVFITEFQENLQSVNRDLNELERLSTLVGRPSESHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASSLLNQQSLKRSANQMGTSAKRRPKVQPSTLALPTQYVDDVISRIGRMFPDMSIELFRPNGTSAVLLVTLGKVLKAIVVMRSLFIDRTIVRGFHENIYTEDRKLDIWSKSNYQAFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQTPCQRCGKYLQEGLPPTWRDFRTLEAFHDTCRQ

MED27

Mediator of RNA polymerase II transcription subunit 27

311 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 27 family.

35.432 kDa

MADVINVSVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ

Med27

Mediator of RNA polymerase II transcription subunit 27

311 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 27 family.

35.298 kDa

MADVLSVGVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIANFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNESVYTEDGKLDIWSKSSYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ

MED27

Mediator of RNA polymerase II transcription subunit 27

311 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 27 family.

35.375 kDa

MADVLSVGVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ

MED27

Mediator of RNA polymerase II transcription subunit 27

311 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 27 family.

35.432 kDa

MADVINVSVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ

med27

Mediator of RNA polymerase II transcription subunit 27

311 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 27 family.

35.479 kDa

MADALNVGVNLEAFSQAIHCIQALRSSVTRVFDCLKDGMKNKESQEARERAFVSEFQDNLHCVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVHDKTPLYSQLLQAYKWSNKLQFHAGLASGLLNQQSLKRSANQMGVSAKRRPKVQPTTLALPPQYIDDVISRIDRMFPEMTIQLSRPNGSSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFRTLEAFHDSCRQ

MED27

Mediator of RNA polymerase II transcription subunit 27

295 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 27 family.

34.076 kDa

MNLEPINNALSHLRMLRSSVGQVFETLGNGVRAEHGEEGKEQKFLQELQELLNGVNSNLREFETCINDLTPPQAPFNLANTAYLSLETNLERQALYPHLVQSYKWHDKLHEYSTFASVLLQQNSLKRSYYTNTKRRRSLPSSHLATPQTVDNLIGSIHFPNMNLKIVRPFMTNAILHITIARVLRAAVILKGLLIEWVTVKGFDESLLDGVDEHWTVSRHQVFRKVQDHAHSAMLHFFSPTLPDLAIRSFITWFRSYLTLFADPCKKCGKHLHNTLPPTWRDLRTLEPYHEECKQ

MED27

Mediator of RNA polymerase II transcription subunit 27

295 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 27 family.

34.021 kDa

MNLEPINNALSQLRVLRSSVGQVFETLGTGVRADHGEEGKEQKFLQELQELLNSVNANLKDFESCINDLTPPQTPLTLANSAYLSLETNLERQALYPHLVQSYKWHDKLHEYSTFASTLLQQNSLKRSYYTNTKRRRSLPSSHLATPQMVENLIGSIHYNNMNLKIARPFMTNAILHITIARVLRAAVILKGLLIEWVTVKGYEESLLDGVDEQWTESRHQVFRKVQDHAHSAMLHFFSPTLPELAIRSFITWFRSYVTLFADPCKKCGKHLHNTLPPTWRDLRTLEPFHEECKQ

MED27

Mediator of RNA polymerase II transcription subunit 27

293 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for activated transcription of the MtnA gene.

Belongs to the Mediator complex subunit 27 family.

33.868 kDa

MDKLNSTLTAVKNLRSNVRLCFEHLADGTDGESGEESRNKFVNDFQERFAAINSQIREVEQLINGLPVPPTPYSLGNTAYLAQETSQDRQALYPQLVNSYKWMDKVHDHSFLAFNNLNQNTLRRSYNYCSQKRQRLPFSSFNNDPDHIDKLLSEINTPPHTSYRIFRPFGTNAVTIVTISNVMKAAIVFKGVLIEWVTVKGFDEPLEHDDLWAESRYEVFRKVQDHAHSAMLHFFSPTLPDLAVKSYITWLNSHVKLFLEPCKRCGKFVVNGLPPTWRDLRTLEPFHEDCRNC

med27

Mediator of RNA polymerase II transcription subunit 27

273 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 27 family.

31.093 kDa

MSLEEQRTRDELKHKLLDLNQLHEQLAELRTICPSLLKLLHPETGTSRKFEKSAQEAIEKVNSFYTHLKSSQNVFDYAEKSLQADSSNLLPTYLYNSEDLSNDTENNETKSINGKSALDLKEPHHSELHDNDNFQNSDINIESFKGDIEASGSILTTHENKSFTLKLANELEFIFFHDTRGKFSVYCSSSKDDAITFSINRNNNFLGNLWSLMPKILDYQHLYSKPCDFCKSLISPVYLELPSVRRNANSTVKPTSKDILALHAECVPAQSDL