MED22

Mediator of RNA polymerase II transcription subunit 22

203 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

23.049 kDa

MAQQRVLPQSKETLLQSYNKRLKDDVKSIMDNFTEIIKTAKIEDETQVSRATQSEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAINQRNQQLRSLQEECDKKLIALRDEISIDLYELEEEYYSSSYSLCDSNDLPLCEAYWREDFDMPSPESLSMPLTTATAEQSIATSQSSTPSHPHVNGHGAGPTDHS

MED22

Mediator of RNA polymerase II transcription subunit 22

203 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

23.049 kDa

MAQQRVLPQSKETLLQSYNKRLKDDVKSIMDNFTEIIKTAKIEDETQVSRATQSEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAINQRNQQLRSLQEECDKKLIALRDEISIDLYELEEEYYSSSYSLCDSNDLPLCEAYWREDFDMPSPESLSMPLTTATAEQSIATSQSSTPSHPHVNGHGAGPTDHS

MED22

Mediator of RNA polymerase II transcription subunit 22

201 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

22.381 kDa

MAQQRALPQSKETLLQSYNKRLKDDVKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRALQEECDRKLIALRDEVSIDLYELEEEYYSSSSSLCEANDLPLCEAYWRLDPDTDSTDCLSAPLLASPEPSAGGPLQAAAPTHSHAGGPGPTEHA

med22

Mediator of RNA polymerase II transcription subunit 22

201 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

22.946 kDa

MSQQRILPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEEEHQVSRSTQGEQDNYEMHVRSANIVRAGESLMKLVSDLKQFLILNDFPSVNESINQRNQQLRTLREECDKKLIALRDDIAIDLYELEEEYYSSSYSVCDPSDLPLCEVYWNRESTASSPEDLSVPLAPIMAEASTVTSQIHTPPHLNGHGAGMTEHT

MED22

Mediator of RNA polymerase II transcription subunit 22

201 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

22.381 kDa

MAQQRALPQSKETLLQSYNKRLKDDVKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRALQEECDRKLIALRDEVSIDLYELEEEYYSSSSSLCEANDLPLCEAYWRLDPDTDSTDCLSAPLLASPEPSAGGPLQAAAPTHSHAGGPGPTEHA

med22

Mediator of RNA polymerase II transcription subunit 22

201 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

22.946 kDa

MSQQRILPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEEEHQVSRSTQGEQDNYEMHVRSANIVRAGESLMKLVSDLKQFLILNDFPSVNESINQRNQQLRTLREECDKKLIALRDDIAIDLYELEEEYYSSSYSVCDPSDLPLCEVYWNRESTASSPEDLSVPLAPIMAEASTVTSQIHTPPHLNGHGAGMTEHT

MED22

Mediator of RNA polymerase II transcription subunit 22

200 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 22 family.

22.221 kDa

MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSSSSLCEANDLPLCEAYGRLDLDTDSADGLSAPLLASPEPSAGPLQVAAPAHSHAGGPGPTEHA

Med22

Mediator of RNA polymerase II transcription subunit 22

200 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

22.282 kDa

MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRALQEECDRKLITLRDEVSIDLYELEEEYYSSSSSLCEANDLPLCEAYWRLDLDADSADGLSAPLLASPETGAGPLQSAAPVHSHGGGPGPTEHT

Med22

Mediator of RNA polymerase II transcription subunit 22

200 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

22.312 kDa

MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRALQEECDRKLITLRDEVSIDLYELEEEYYSSSSSLCEANDLPLCEAYWRLDLDTDSADGLSAPLLASPETGAGPLQSAAPVHSHGGGPGPTEHT

med22

Mediator of RNA polymerase II transcription subunit 22

200 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

22.923 kDa

MATQRVLPQSKETLLQSYNKRLKDDIKSILENFTEIIKTAKIEDETQVSRPAQAEQDHYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNDAISLQNQQLRSLQEECDKKLISLRDEIAIDLYELEEEYYSSSYSQWDTDLPLCEAYHRVDNWASPSSSSSSTQGDQEEVEILPSQETEPQHHLNGQGTSSLEKM

MED22

Mediator of RNA polymerase II transcription subunit 22

200 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 22 family.

22.221 kDa

MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSSSSLCEANDLPLCEAYGRLDLDTDSADGLSAPLLASPEPSAGPLQVAAPAHSHAGGPGPTEHA

Med22

Mediator of RNA polymerase II transcription subunit 22

200 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

22.282 kDa

MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRALQEECDRKLITLRDEVSIDLYELEEEYYSSSSSLCEANDLPLCEAYWRLDLDADSADGLSAPLLASPETGAGPLQSAAPVHSHGGGPGPTEHT

Med22

Mediator of RNA polymerase II transcription subunit 22

200 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

22.312 kDa

MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRALQEECDRKLITLRDEVSIDLYELEEEYYSSSSSLCEANDLPLCEAYWRLDLDTDSADGLSAPLLASPETGAGPLQSAAPVHSHGGGPGPTEHT

med22

Mediator of RNA polymerase II transcription subunit 22

200 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

22.923 kDa

MATQRVLPQSKETLLQSYNKRLKDDIKSILENFTEIIKTAKIEDETQVSRPAQAEQDHYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNDAISLQNQQLRSLQEECDKKLISLRDEIAIDLYELEEEYYSSSYSQWDTDLPLCEAYHRVDNWASPSSSSSSTQGDQEEVEILPSQETEPQHHLNGQGTSSLEKM

med22

Mediator of RNA polymerase II transcription subunit 22

198 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

22.681 kDa

MSTPRVLPQSKETLLQNYNKRLKDDIRSILDNFTEIIKTAKVEDETQVSRATQAEQDHFEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAISLRNQQLRTLQEECDKKLISLRDEIAIDLYELEEEYYSSSCGQWDGVELPLCEAFHRQDSWGSPEMTSDPSHANHEVSDHLGSQESMQRHRNGSGTSEQS

med22

Mediator of RNA polymerase II transcription subunit 22

198 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

22.681 kDa

MSTPRVLPQSKETLLQNYNKRLKDDIRSILDNFTEIIKTAKVEDETQVSRATQAEQDHFEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAISLRNQQLRTLQEECDKKLISLRDEIAIDLYELEEEYYSSSCGQWDGVELPLCEAFHRQDSWGSPEMTSDPSHANHEVSDHLGSQESMQRHRNGSGTSEQS

med22

Putative mediator of RNA polymerase II transcription subunit 22

149 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

17.283 kDa

MNTGGNNSLPPQTRGEVLFRDQQFFQKQIDSKIMQLLENYHNIIKISKVNDPLKNASEIYEMETRTSNMLNAGEGLLKIIEELKQNLILNDFSTMAEEVRIQNLVFHKENERTNKSIKLISEELSRSLKELEDEYYNSSYKLPPPSSSK

med22

Putative mediator of RNA polymerase II transcription subunit 22

149 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

17.283 kDa

MNTGGNNSLPPQTRGEVLFRDQQFFQKQIDSKIMQLLENYHNIIKISKVNDPLKNASEIYEMETRTSNMLNAGEGLLKIIEELKQNLILNDFSTMAEEVRIQNLVFHKENERTNKSIKLISEELSRSLKELEDEYYNSSYKLPPPSSSK

MED22

Mediator of RNA polymerase II transcription subunit 22

143 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 22 family.

16.594 kDa

MASGSRTTILPQSKEALLKSYNARLKDDVRSMLENFEEILKLARRESHSQISKTTQCEQDALEMQVRAANMVRAGESLMKLVADLKQYLILNDFHSVNEAITNNSQLFRNTQSECDKKLMKLRDEMAMDLYDLEEEYYTSIFK

MED22

Mediator of RNA polymerase II transcription subunit 22

143 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 22 family.

16.594 kDa

MASGSRTTILPQSKEALLKSYNARLKDDVRSMLENFEEILKLARRESHSQISKTTQCEQDALEMQVRAANMVRAGESLMKLVADLKQYLILNDFHSVNEAITNNSQLFRNTQSECDKKLMKLRDEMAMDLYDLEEEYYTSIFK

MED22

Mediator of RNA polymerase II transcription subunit 22

138 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

16.225 kDa

MQRNLTQSKEALLKSYNTRLKEDVRSMLDNFEEIVRLAKGENETQFSKMTQCEQDTYEMQVRASNIVRAGESLMKLVSDIKQYLILNDFHSVNEAICSSSQLYRSTQMDRDNKLMAVRDDMAADLYDLEEEYYTSMYK

MED22

Mediator of RNA polymerase II transcription subunit 22

138 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity).

Belongs to the Mediator complex subunit 22 family.

16.162 kDa

MQRNLTQSKEALLKSYNSRLKEDIRSMRENFEEIIRLAKGENDTQLSKITQCEQDTYETQVRAANIVRAGESLMKLVSDIKQYLILNDFHSVNEAICSNSTLYRTTQIDRDNKLMAVRDDMAADLYDLEEEYYTSIYK

med22

Mediator of RNA polymerase II transcription subunit 22

136 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 22 family.

15.382 kDa

MSSDSFQRQLVQRTNTLNSSIDNATLTILSRFQDILDIAINEGKDKYTVAPEVYQIECHTVSMVRAVEQLLDVSRQIKSYWLTNSLSTSFPTVDYSEPDLEKVKRTLTKLQNHLLEVSLIEPEASETTEAPTVSDT

med22

Mediator of RNA polymerase II transcription subunit 22

136 amino acids

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Belongs to the Mediator complex subunit 22 family.

15.382 kDa

MSSDSFQRQLVQRTNTLNSSIDNATLTILSRFQDILDIAINEGKDKYTVAPEVYQIECHTVSMVRAVEQLLDVSRQIKSYWLTNSLSTSFPTVDYSEPDLEKVKRTLTKLQNHLLEVSLIEPEASETTEAPTVSDT