Function
Monofunctional DNA glycosylase targeting U:G and T:G mispairs (PubMed:23994068). Excises uracil derivatives and exhibits a preference for a CpG sequence context, irrespective of the methylation status of the complementary strand (PubMed:23994068). The activity follows a biphasic kinetics, with an initial burst of product accumulation followed by a slower phase (PubMed:23994068). Specifically binds its reaction product (PubMed:23994068). Triggers the base excision repair (BER) pathway (PubMed:25900572).
Sequence
MVPPIIYKYKRRKDRRLGRDDDSSVMMTRRRPDSDFIEVSDENRSFALFKEDDEKNRDLGLVDDGSTNLVLQCHDDGCSLEKDNSNSLDDLFSGFVYKGVRRRKRDDFGSITTSNLVSPQIADDDDDSVSDSHIERQECSEFHVEVRRVSPYFQGSTVSQQSKEGCDSDSVCSKEGCSKVQAKVPRVSPYFQASTISQCDSDIVSSSQSGRNYRKGSSKRQVKVRRVSPYFQESTVSEQPNQAPKGLRNYFKVVKVSRYFHADGIQVNESQKEKSRNVRKTPIVSPVLSLSQKTDDVYLRKTPDNTWVPPRSPCNLLQEDHWHDPWRVLVICMLLNKTSGAQTRGVISDLFGLCTDAKTATEVKEEEIENLIKPLGLQKKRTKMIQRLSLEYLQESWTHVTQLHGVGKYAADAYAIFCNGNWDRVKPNDHMLNYYWDYLRIRYKL