About Products Protein Database Contact

M1425_1359

Gene
M1425_1359
Protein
UPF0148 protein M1425_1359
Organism
Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
Length
118 amino acids
Similarity
Belongs to the UPF0148 family.
Mass
13.445 kDa
Sequence
MTNESEVGVKKAAELLRQGATMLEEACPICKMPLFKLKNGDVVCPVHGKVYIVKSDDEEKIVKRNLQLDEIESILIDGLYLSAKKMKEDPLDSERIIQIIRYLDALERLRKIKINSSE