LTP3

Probable non-specific lipid-transfer protein 3

122 amino acids

Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

Belongs to the plant LTP family.

12.336 kDa

MARLNSKAVAAAVVLAAVVLMMAGREASAALSCGQVDSKLAPCVAYVTGRASSISKECCSGVQGLNGLARSSPDRKIACRCLKSLATSIKSINMGKVSGVPGKCGVSVPFPISMSTNCNNVN

LTP3

Non-specific lipid-transfer protein 3

118 amino acids

Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Belongs to the plant LTP family.

11.741 kDa

MARAAATQLVLVAMVAAMLLVATDAAISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACRCLKSLATSIKGINMGKVSGVPGKCGVSVPFPISMSTDCNKVH

LTP3

Non-specific lipid-transfer protein 3

117 amino acids

Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Belongs to the plant LTP family.

11.741 kDa

MAGLVKLSCLVLACMIVAGPIATNAALSCGTVSGNLAACIGYLTQNGPVPTACCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTNCNSVK

LTP3

Non-specific lipid-transfer protein 3

115 amino acids

Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

Belongs to the plant LTP family.

11.694 kDa

MAFALRFFTCLVLTVCIVASVDAAISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSISGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK