LSM8

U6 snRNA-associated Sm-like protein LSm8

109 amino acids

Component of the nuclear LSM2-LSM8 complex, which is involved in splicing of nuclear mRNAs. LSM2-LSM8 associates with multiple snRNP complexes containing the U6 snRNA (U4/U6 snRNP, spliceosomal U4/U6.U5 snRNP, and free U6 snRNP). It binds directly to the U6 snRNA and plays a role in the biogenesis and stability of the U6 snRNP and U4/U6 snRNP complexes. It probably also is involved in degradation of nuclear pre-mRNA by targeting them for decapping. LSM2-LSM8 probably is involved in processing of pre-tRNAs, pre-rRNAs and U3 snoRNA. LSM2 is required for processing of pre-tRNAs, pre-rRNAs and U3 snoRNA.

Belongs to the snRNP Sm proteins family.

12.385 kDa

MSATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSEIALVGLIDAENDDSLAPIDEKKVPMLKDTKNKIENEHVIWEKVYESKTK

LSM8

Sm-like protein LSM8

98 amino acids

Component of the nuclear LSM2-LSM8 complex which is involved splicing nuclear mRNAs. LSM2-LSM8 binds directly to the U6 small nuclear RNAs (snRNAs). LSM8 is essential for the formation of the nuclear LSM2-LSM8 complex involved in the accurate splicing of selected development-related mRNAs through the stabilization of the spliceosomal U6 snRNA. Plays a critical role in the regulation of development-related gene expression.

Belongs to the snRNP Sm proteins family.

10.706 kDa

MAATTGLETLVDQIISVITNDGRNIVGVLKGFDQATNIILDESHERVFSTKEGVQQHVLGLYIIRGDNIGVIGELDEELDASLDFSKLRAHPLKPVVH

LSM8

U6 snRNA-associated Sm-like protein LSm8

96 amino acids

Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

Belongs to the snRNP Sm proteins family.

10.403 kDa

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

LSM8

U6 snRNA-associated Sm-like protein LSm8

96 amino acids

Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex) (PubMed:28781166). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA (PubMed:10523320).

Belongs to the snRNP Sm proteins family.

10.403 kDa

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

Lsm8

U6 snRNA-associated Sm-like protein LSm8

96 amino acids

Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

Belongs to the snRNP Sm proteins family.

10.403 kDa

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

LSM8

U6 snRNA-associated Sm-like protein LSm8

96 amino acids

Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

Belongs to the snRNP Sm proteins family.

10.403 kDa

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

lsm8

Probable U6 snRNA-associated Sm-like protein LSm8

94 amino acids

Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

Belongs to the snRNP Sm proteins family.

10.433 kDa

MAMLESYLKKQVLVLTADGRSIIGTLRGIDQTINVVLEKCHERVYSDEGIEVIPLGVHLIKGDDVAVIGEVDDELDKKLNLKEIIAEPMKPIVH

lsm8

U6 snRNA-associated Sm-like protein LSm8

94 amino acids

Probable component of the spliceosome.

Belongs to the snRNP Sm proteins family.

10.563 kDa

MSLADFMEQRVQVITNDGRVVLGSLKGFDHTTNLILSDSFERIISMDQDMETIPLGVYLLRGENVAMVGLVNEELDSEIEWTKIRGEAIPDVVH