Lrrc38

Leucine-rich repeat-containing protein 38

298 amino acids

Auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha). Modulates gating properties by producing a marked shift in the BK channel's voltage dependence of activation in the hyperpolarizing direction, and in the absence of calcium (By similarity).

32.343 kDa

MSLCVAPRHPTGAAAALGLGSLLVLLGPGRACPAGCACTDPHTVDCRDRGLPSVPDPFPLDVRKLLVAGNRIQQIPEDFFIFHGDLVYLDFRNNSLRSLEEGTFSGSGKLAFLDLSYNNLTQLGAGAFRSAGRLVKLSLANNHLAGVHEAAFESLESLQVLELNDNNLRSLNVAALDALPALRTVRLDGNPWLCDCDFAHLFSWIQENTSKLPKGLDAIQCSLPMEDRRVALRELSEASFSECKFSLSLTDLFIIIFSGVAVSIAAIISSFFLATVVQCFQRCAPNKDTEDEDDDEDD

LRRC38

Leucine-rich repeat-containing protein 38

294 amino acids

Auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha). Modulates gating properties by producing a marked shift in the BK channel's voltage dependence of activation in the hyperpolarizing direction, and in the absence of calcium.

32.082 kDa

MRPRAPACAAAALGLCSLLLLLAPGHACPAGCACTDPHTVDCRDRGLPSVPDPFPLDVRKLLVAGNRIQRIPEDFFIFYGDLVYLDFRNNSLRSLEEGTFSGSAKLVFLDLSYNNLTQLGAGAFRSAGRLVKLSLANNNLVGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRSLRLDGNPWLCDCDFAHLFSWIQENASKLPKGLDEIQCSLPMESRRISLRELSEASFSECRFSLSLTDLCIIIFSGVAVSIAAIISSFFLATVVQCLQRCAPNKDAEDEDEDKDD