LRRC25

Leucine-rich repeat-containing protein 25

307 amino acids

Plays a role in the inhibition of RLR-mediated type I interferon signaling pathway by targeting DDX58/RIG-I for autophagic degradation. Interacts specifically with ISG15-associated DDX58 to promote interaction between DDX58 and the autophagic cargo receptor p62/SQSTM1 to mediate DDX58 degradation via selective autophagy. Plays also a role in the inhibition of NF-kappa-B signaling pathway and inflammatory response by promoting the degradation of p65/RELA.

33.934 kDa

MGGPLMWALLLPLLLHQAGSQTSSCSVLSGYMDWTKEYFDTCLNFSGKILTQLPQNQSLRARSVQLLDLSANGLQRLPWSFFRDLEQLQLLIVTNNSLDFVDRALXXXGCGLELLADCSCALLDWHTDRQDNCSGPELPRCLDVPTGAWHNLSVFLDVSCPSGLTKIAIGALAASGSLLLVLAIAGPVLAWRFCRHRMDQNLSKTWASQDGSRSGSGRQPRYSSQGRRPKSPANTPPRSSTPDYENVFVGPPAARHQWDELRSPPSEGGDFYMTYDSLQHESQPVYCNLQSLSQVPLDDEEYVVPGR

LRRC25

Leucine-rich repeat-containing protein 25

305 amino acids

Plays a role in the inhibition of RLR-mediated type I interferon signaling pathway by targeting DDX58/RIG-I for autophagic degradation. Interacts specifically with ISG15-associated DDX58 to promote interaction between DDX58 and the autophagic cargo receptor p62/SQSTM1 to mediate DDX58 degradation via selective autophagy (PubMed:29288164). Plays also a role in the inhibition of NF-kappa-B signaling pathway and inflammatory response by promoting the degradation of p65/RELA.

33.179 kDa

MGGTLAWTLLLPLLLRESDSLEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATIGAVVVSGCLLLGLAIAGPVLAWRLWRCRVARSRELNKPWAAQDGPKPGLGLQPRYGSRSAPKPQVAVPSCPSTPDYENMFVGQPAAEHQWDEQGAHPSEDNDFYINYKDIDLASQPVYCNLQSLGQAPMDEEEYVIPGH

Lrrc25

Leucine-rich repeat-containing protein 25

297 amino acids

Plays a role in the inhibition of RLR-mediated type I interferon signaling pathway by targeting DDX58/RIG-I for autophagic degradation. Interacts specifically with ISG15-associated DDX58 to promote interaction between DDX58 and the autophagic cargo receptor p62/SQSTM1 to mediate DDX58 degradation via selective autophagy. Plays also a role in the inhibition of NF-kappa-B signaling pathway and inflammatory response by promoting the degradation of p65/RELA.

32.673 kDa

MGSIRTRLLWLCLLMLLALLHKSGSQDLTCMVHPSRVDWTQTFNGTCLNFSGLGLSLPRSPLQASHAQVLDLSKNGLQVLPGAFFDKLEKLQTLIVTHNQLDSVDRSLALRCDLELKADCSCGLASWYALRQNCSGQQQLLCLHPATEAPRNLSTFLQVSCPPSWGPGTIGALVAGTISLAVAVSGSVLAWRLLRRRRRASEHSLSKAQMSPHDIPKPVTDFLPRYSSRRPGPKAPDSPPSRFTMDYENVFIGQPAEDCSWSAARNSPSGDSDCYMNYRSVDQDSQPVYCNLESLGR