LMCD1

LIM and cysteine-rich domains protein 1

365 amino acids

Transcriptional cofactor that restricts GATA6 function by inhibiting DNA-binding, resulting in repression of GATA6 transcriptional activation of downstream target genes. Represses GATA6-mediated trans activation of lung- and cardiac tissue-specific promoters. Inhibits DNA-binding by GATA4 and GATA1 to the cTNC promoter (By similarity). Plays a critical role in the development of cardiac hypertrophy via activation of calcineurin/nuclear factor of activated T-cells signaling pathway.

40.833 kDa

MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

Lmcd1

LIM and cysteine-rich domains protein 1

365 amino acids

Transcriptional cofactor that restricts GATA6 function by inhibiting DNA-binding, resulting in repression of GATA6 transcriptional activation of downstream target genes. Represses GATA6-mediated trans activation of lung- and cardiac tissue-specific promoters. Inhibits DNA-binding by GATA4 and GATA1 to the cTNC promoter. Plays a critical role in the development of cardiac hypertrophy via activation of calcineurin/nuclear factor of activated T-cells signaling pathway.

40.996 kDa

MAKVAKDLNPGVQKMSLGQQQSARGVACLRCKGMCSGFEPHSWRKICKSCKCSQEEHCLSSDLDDDRKIGRLLMDSKYATLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKERQPVTGTEGALYRRRQLMHQLPIYDQDPSRCRGLVENELKAMEEFVKHYKSEALGVGEVALPGQGGLPKEENKTQEKPEGTETTAPTTNGSLGDPSKEVEYVCELCKGAAPVDSPVVYADRAGYSKQWHPTCFQCIKCSEPLVDLIYFWKDGAPWCGRHYCESVRPRCSGCDEIIFSEDYQRVEDLAWHRKHFICEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

LMCD1

LIM and cysteine-rich domains protein 1

363 amino acids

Transcriptional cofactor that restricts GATA6 function by inhibiting DNA-binding, resulting in repression of GATA6 transcriptional activation of downstream target genes. Represses GATA6-mediated trans activation of lung- and cardiac tissue-specific promoters. Inhibits DNA-binding by GATA4 and GATA1 to the cTNC promoter. Plays a critical role in the development of cardiac hypertrophy via activation of calcineurin/nuclear factor of activated T-cells signaling pathway (By similarity).

40.723 kDa

MAKVAKDLNPRVQKMSLGQQQSARGVPCLRCKGTCSGFEPHSWRKICKSCKCSQEDHCLSSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGALYRRRQLMHQLPIYDQDPSRCRGLLENELKVMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETAPPTTNGSIGDPSKEYVCELCKGVAPADSPVVYSDRAGYSKQWHPACFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFSEDYQRVEDLAWHRKHFVCEGCEQQLGGRAYIVTMGQLLCPTCSKSKRS

LMCD1

LIM and cysteine-rich domains protein 1

363 amino acids

Transcriptional cofactor that restricts GATA6 function by inhibiting DNA-binding, resulting in repression of GATA6 transcriptional activation of downstream target genes. Represses GATA6-mediated trans activation of lung- and cardiac tissue-specific promoters. Inhibits DNA-binding by GATA4 and GATA1 to the cTNC promoter. Plays a critical role in the development of cardiac hypertrophy via activation of calcineurin/nuclear factor of activated T-cells signaling pathway (By similarity).

40.66 kDa

MAKVAKDLNPGVQKMSLGQQQSARGVPCLRCKGTCSGFEPHSWRKICKSCKCSQEDHFLSSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAYYRRRQLMHQLPIYDQDPSRCRGLLESELKVMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETAAPTANGSLGDPSKEYVCELCKGVAPADSPVVYSDRAGYSKQWHPACFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFSEDYQRVEDLAWHRKHFVCEGCEQQLGGRAYIITKGQLLCPTCSKSKRT