lias

Lipoyl synthase, mitochondrial

399 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

44.394 kDa

MALISRSCGAASRYSSSHLFLPSKGAEAANVYCNRLSTAASTSSSSSPSPSTHNDRKKDLREDGLNLQDFISGELSEKSKWEEYRGNLKREKGERLRLPPWLKTEIPIGKNYNKLKNTLRELNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARRPPPLDPDEPYNTAKAIAAWGLDYVVLTSVDRDDIPDGGAEHFAKTVSNIKERNSKILVECLTPDFRGDLAAVEKIALSGLDVYAHNVETVRELQRHVRDPRANFDQSLSVLRHAKKVKSSVLTKTSIMLGLGETDAQIQATLTELRDSGVDCLTLGQYMQPTKRHLKVEEYVTPEKFAFWEKVGQEMGFIYTASGPLVRSSYKAGEFFLKNLLEKRKTEETTATAE

Lias

Lipoyl synthase, mitochondrial

373 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

41.879 kDa

MALRCWDTARSLGSRIFGRYAFTVRALSSLPDKKKEFLHNGPDLQDFVSGDLADKSTWDEYKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLSLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDANEPDNTAKAIAEWGLDYVVLTSVDRDDVADGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLRHAKEVQPDVVSKTSIMLGLGETDEQVYATLKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEKVGNELGFLYTASGPLVRSSYKAGEFFLKNLVARRKTKASKV

Lias

Lipoyl synthase, mitochondrial

373 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

41.874 kDa

MALRCWDAARSLGSRIFGRYACSVRALSSLPDEKKKFLHNGPDLQDFVSGDLADKSTWDDYKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDPSEPDNTARAIAEWGLDYVVLTSVDRDDVVDGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLKHAKEVQPDVVSKTSIMLGLGETDEQVYATMKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEEVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKVSKV

Lias

Lipoyl synthase, mitochondrial

373 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

41.879 kDa

MALRCWDTARSLGSRIFGRYAFTVRALSSLPDKKKEFLHNGPDLQDFVSGDLADKSTWDEYKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLSLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDANEPDNTAKAIAEWGLDYVVLTSVDRDDVADGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLRHAKEVQPDVVSKTSIMLGLGETDEQVYATLKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEKVGNELGFLYTASGPLVRSSYKAGEFFLKNLVARRKTKASKV

Lias

Lipoyl synthase, mitochondrial

373 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

41.874 kDa

MALRCWDAARSLGSRIFGRYACSVRALSSLPDEKKKFLHNGPDLQDFVSGDLADKSTWDDYKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDPSEPDNTARAIAEWGLDYVVLTSVDRDDVVDGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLKHAKEVQPDVVSKTSIMLGLGETDEQVYATMKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEEVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKVSKV

LIAS

Lipoyl synthase, mitochondrial

372 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

41.911 kDa

MSLRCGDAARTLGPRVFGRYFCSPVRPLSSLPDKKKELLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDASEPYNTAKAIAEWGLDYVVLTSVDRDDMPDGGAEHIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQSKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKDL

lias

Lipoyl synthase, mitochondrial

372 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

41.803 kDa

MRQCGLVRAAQLLRTCGLAEWHTPYRALSSLPDEKKELIKNGPDLQDFLSGELVDKSSWAAYKGDLKRQKGERLRLPPWVKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYGTATATIMLMGDTCTRGCRFCSVKTARNPPPLDPDEPYNTSKAIAEWGLDYVVLTSVDRDDISDGGAEHIAQTVSMLKERNKTILIECLTPDFRGNMKAVETVAKSGLDVYAHNVETVPALQRHVRDPRANFDQSLNVLKHAKNVRPDLVSKTSIMLGLGETDEQIYSTMKALREAGVDCLTLGQYMQPTKRHLKVEEYITPEKFKYWEKAGNELGFLYTASGPLVRSSYKAGEFFLKNLIEKRKTKAI

LIAS

Lipoyl synthase, mitochondrial

372 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

41.911 kDa

MSLRCGDAARTLGPRVFGRYFCSPVRPLSSLPDKKKELLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDASEPYNTAKAIAEWGLDYVVLTSVDRDDMPDGGAEHIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQSKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKDL

lias

Lipoyl synthase, mitochondrial

372 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

41.803 kDa

MRQCGLVRAAQLLRTCGLAEWHTPYRALSSLPDEKKELIKNGPDLQDFLSGELVDKSSWAAYKGDLKRQKGERLRLPPWVKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYGTATATIMLMGDTCTRGCRFCSVKTARNPPPLDPDEPYNTSKAIAEWGLDYVVLTSVDRDDISDGGAEHIAQTVSMLKERNKTILIECLTPDFRGNMKAVETVAKSGLDVYAHNVETVPALQRHVRDPRANFDQSLNVLKHAKNVRPDLVSKTSIMLGLGETDEQIYSTMKALREAGVDCLTLGQYMQPTKRHLKVEEYITPEKFKYWEKAGNELGFLYTASGPLVRSSYKAGEFFLKNLIEKRKTKAI

LIAS

Lipoyl synthase, mitochondrial

372 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

42.035 kDa

MSLRCGGAVRTVGPRVFGRYVFSPVREVSFLPDEKKEFLQSGPDLQEFISGNLADKSTWDEYKGNLKRQKGERLRLPPWLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDANEPYNTAKAIAEWGLDYVVLTSVDRDDMPDGGAEHFAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLKHAKEVRPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTKRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKAL

liaS

Sensor histidine kinase LiaS

360 amino acids

Member of the two-component regulatory system LiaS/LiaR probably involved in response to a subset of cell wall-active antibiotics that interfere with the lipid II cycle in the cytoplasmic membrane (bacitracin, nisin, ramoplanin and vancomycin). Seems also involved in response to cationic antimicrobial peptides and secretion stress. Activates probably LiaR by phosphorylation.

40.704 kDa

MRKKMLASLQWRAIRMTTGISLLLFVCLISFMMFYYRLDPLVLLSSSWFGIPFILILLLISVTVGFASGYMYGNRLKTRIDTLIESILTFENGNFAYRIPPLGDDEIGLAADQLNEMAKRVELQVASLQKLSNERAEWQAQMKKSVISEERQRLARDLHDAVSQQLFAISMMTSAVLEHVKDADDKTVKRIRMVEHMAGEAQNEMRALLLHLRPVTLEGKGLKEGLTELLDEFRKKQPIDIEWDIQDTAISKGVEDHLFRIVQEALSNVFRHSKASKVTVILGIKNSQLRLKVIDNGKGFKMDQVKASSYGLNSMKERASEIGGVAEVISVEGKGTQIEVKVPIFPEEKGENERDSSIID