Function
Required to activate transcription of PDR3, a gene involved in retrograde regulation of multidrug resistance, a phenomenon that takes place in cells that have lost their mitochondrial genome. Also required for ubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation, telomeric silencing, and is also a prerequisite for H3K4me and H3K79me formation. Its precise role in H2BK123ub1 formation however is unclear and is independent of retrograde regulation of multidrug resistance function.
Sequence
MSGYTGNNYSRYSSTPPRQRGGYHHARRSRGGAGGSYYRGGNASYGARYNSDYEQPPQEGDLRQTGAYYRNGYTDTRPYYSANSRHYQAQPSPRYNNGTNSYHLPQRGNSQDTNGRTTSASQEDNDEKRVKSRYRNMQADHPRQQPMSVGSTSSRNGSSGNSSTSSTSNGLPPPPSVSSITNNRSYHSSAYPYSSSHTYNNYHHRETPPPPPSNGYYAKGYPVHVPENRSNSDGSSSSVVKKKRILDMKDSPFIYLTDFDKNVKKTNNTESECEKAREVFKESDSIDSALEELNLKINSNELELRLLNNQCDKHALNIQLTQEKLDSLLLMQ