LEPROT

Leptin receptor gene-related protein

131 amino acids

Negatively regulates leptin receptor (LEPR) cell surface expression, and thus decreases response to leptin/LEP. Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability (By similarity).

Belongs to the OB-RGRP/VPS55 family.

14.228 kDa

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRATYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVSVIKWGACGLVLAGNAVIFLTIQGFFLVFGRGDDFSWEQW

LEPROT

Leptin receptor gene-related protein

131 amino acids

Involved in protein trafficking. May be involved in the down-regulation of membrane protein levels (By similarity).

Belongs to the OB-RGRP/VPS55 family.

14.389 kDa

MAGIKALVGLSFSGAIGLTFLMLGCALEYYGVYWPMFVLIFYFICPIPHFIARRVSDDSDAASSACRELAYFFTTGIVVSAFGFPIILARVEAIKWGACGLVLAGNAVIFLTILGFFLVFGRGDDFSWEQW

LEPROT

Leptin receptor gene-related protein

131 amino acids

Negatively regulates leptin receptor (LEPR) cell surface expression, and thus decreases response to leptin. Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability.

Belongs to the OB-RGRP/VPS55 family.

14.254 kDa

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIFGRGDDFSWEQW

LEPROT

Leptin receptor gene-related protein

131 amino acids

Involved in protein trafficking. May be involved in the down-regulation of membrane protein levels (By similarity).

Belongs to the OB-RGRP/VPS55 family.

14.389 kDa

MAGIKALVGLSFSGAIGLTFLMLGCALEYYGVYWPMFVLIFYFICPIPHFIARRVSDDSDAASSACRELAYFFTTGIVVSAFGFPIILARVEAIKWGACGLVLAGNAVIFLTILGFFLVFGRGDDFSWEQW

Leprot

Leptin receptor gene-related protein

131 amino acids

Negatively regulates leptin receptor (LEPR) cell surface expression, and thus decreases response to leptin. Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability.

Belongs to the OB-RGRP/VPS55 family.

14.316 kDa

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGLPVVLARVDVIKWGACGLVLAGNAVIFLTIQGFFLVFGRGDDFSWEQW

LEPROT

Leptin receptor gene-related protein

131 amino acids

Negatively regulates leptin receptor (LEPR) cell surface expression, and thus decreases response to leptin/LEP. Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability (By similarity).

Belongs to the OB-RGRP/VPS55 family.

14.198 kDa

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLVFHALSPIPHFIAKRATYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLVFGRGDDFSWEQW

Leprot

Leptin receptor gene-related protein

131 amino acids

Negatively regulates leptin receptor (LEPR) cell surface expression, and thus decreases response to leptin (By similarity). Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability.

Belongs to the OB-RGRP/VPS55 family.

14.32 kDa

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFYVISPIPYFIAKRVTYDSDATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLVFGRGDDFSWEQW

leprot

Leptin receptor gene-related protein

130 amino acids

Involved in protein trafficking. May be involved in the down-regulation of membrane protein levels (By similarity).

Belongs to the OB-RGRP/VPS55 family.

14.13 kDa

MAGIKALVALSFSGALGLTFLLLGCALEQFGQYWPMFVLIFYILSPIPNLIARRHADDTESSNACRELAYFLTTGIVVSAYGLPVVLARKAVIQWGAAGLVMAGNCVIFLTILGFFLIFGGGDDFSWEQW

leprot

Leptin receptor gene-related protein

130 amino acids

Involved in protein trafficking. May be involved in the down-regulation of membrane protein levels (By similarity).

Belongs to the OB-RGRP/VPS55 family.

13.992 kDa

MAGIKALVGLSFSGAMGLTLLLLGCALEQYGIYWPLFVLIFYVLSPIPTFISRRLSDGGSSSNACRELAYFLTTGIVVSSFGLPIVLARTATIQWGACGLVMTGNAVIFLTIFGFFVVFGGGDEFSWEQW