Klrb1f

Killer cell lectin-like receptor subfamily B member 1F

217 amino acids

Binds CLEC2I/Clr-g leading to activation of natural killer cells or costimulation of IL-2 production and proliferation of T-cells in response to antigen stimulation. May contribute to the formation of the immunological synapse between T-cells and antigen-presenting dendritic cells.

24.681 kDa

MDTSKVHGNVKPFRCPGYKQASSPSFSPDACRCPHWHHLALKSGCAGLILLLLSLIGLSVLVRFLVQKPPIEKCSVAAQENRTELTGRSAILECPRYWHPHWNKCLFVSQISRPWAEGRDACSMEDAILLLIENKEELRFVQNLIKGKEQLFFIGLKYVQKEKIWKWIDGSILNPNLLRITGKDKENSCAIISHTEVFSDSCSSDNHWICQKTLIHV

Klrb1f

Killer cell lectin-like receptor subfamily B member 1F

217 amino acids

Binds CLEC2I/Clr-g leading to activation of natural killer cells or stimulation of IL-2 production and proliferation of T-cells in response to antigen stimulation. May contribute to the formation of the immunological synapse between T-cells and antigen-presenting dendritic cells (By similarity).

24.543 kDa

MDTSRVYGNVKTFRSPGHKQASFPSLSTDACRCPHWHHLALKLGCATLILLLLTLIGLSVFVRFLVQKPLIEKCSMAAQENGTEPTGRSAILECPRHWQPHRNKCLIISQISRPWAEGLVACSMKEATLLIIENEEELKFVQNILKGRQQLFFIGLNYVQTEMTWKWINGSVLKPNILRITGSEVENSCALISHTEVFSDSCSSDNHWICQKTLKHV