Function
Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond (By similarity). Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro) (By similarity).
Sequence
MFLAWERLCTLSCRPKFLKTVWASKILGLSTSAKMSLRFKNAKRIEGLDSNIWIEFTKLAADPSVVNLGQGLPDISPPVYVKEELSKIAAIDNLNQYTRGFGHPSLVKALSCLYEKFYHNKINPNEEILVTVGAYGSLFNAIQGLIDEGDEVIVIVPFFDCYESMVRMAGATPVFVPLRCKPVDGKKCSSSDWTLDPQELASKFNSKTKAIILNTPHNPLGKVYTKEELQVIADLCIKYDTLCISDEVYEWLVYTGNKHFKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPKHLIKHLQTVQQNTVYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVHLLESVGLKSIVPDGGYFIIADVSLLDVDLLDMKDSNEPYDYKFVKWMIKNKKLSAIPVSAFCNAETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSRQNS