About Products Protein Database Contact

KTR2

Gene
KTR2
Protein
Probable mannosyltransferase KTR2
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
425 amino acids
Function
Involved in N-linked glycosylation. Transfers an alpha-D-mannosyl residue from GDP-mannose into lipid-linked oligosaccharide, forming an alpha-(1->2)-D-mannosyl-D-mannose linkage.
Similarity
Belongs to the glycosyltransferase 15 family.
Mass
50.651 kDa
Sequence
MQICKVFLTQVKKLLFVSLLFCLIAQTCWLALVPYQRQLSLDSYFFRRSREVSSRYDFTRRRHMNQTLKLSSNTYNDEPLNKTKGIKNQRENATLLMLVRNWELSGALRSMRSLEDRFNKNYQYDWTFLNDVPFDQEFIEATTAMASGRTQYALIPAEDWNRPSWINETLFEEALQLMEEKNILYGGSKSYRNMCRFNSGFFFRQKILDPYDFYFRVEPDVEYFCDFPYDPFKVMRQNNKKYGFVITMYEYEDTIPSLWEAVEEYLEETESADIDMESNAFGFVSNFDFIGKSFGVIDSNSGYNLCHFWTNFEIGDLNFFRSEKYIRFFEYLDSKGGFYYERWGDAPVHSIAASLLLKKDEIIHFDELGYKHMPFGTCPSAYYLRLQQRCLCDSNHPDNIDLNVISCLRRWWKDGSGKYFLKHDS