KRTAP3-1

Keratin-associated protein 3-1

98 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins (By similarity).

Belongs to the KRTAP type 3 family.

10.408 kDa

MAYCAPYCCSVPTGPATTICSSDKFCRCGVCLPSTCPHEISLLQPTCCDNCPPPCCVPDTYVPTCWLLNSSHPTPGLSGINLTTFVQPGCDNVCEPRC

KRTAP3-1

Keratin-associated protein 3-1

98 amino acids

In the wool cortex, wool keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant wool shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of wool keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the KRTAP type 3 family.

10.471 kDa

MACCAPRCCSVRTGPATTICSSDQFCRCGVCLPSTCPHDISLLQPTFCDNSPVPYHVPDTYVPTCFLLNSSHPTPGLSGINLTTFIQPGCENACEPRC

KRTAP3-1

Keratin-associated protein 3-1

98 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the KRTAP type 3 family.

10.539 kDa

MYCCALRSCSVPTGPATTFCSFDKSCRCGVCLPSTCPHEISLLQPICCDTCPPPCCKPDTYVPTCWLLNNCHPTPGLSGINLTTYVQPGCESPCEPRC

Krtap3-1

Keratin-associated protein 3-1

98 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins (By similarity).

Belongs to the KRTAP type 3 family.

10.271 kDa

MACCVARCCSVPTGPATTICSSDKSCRCGVCLPSTCPHEISLLQPTCCDPCPPPCCQPEVYVPTCWLLNSCHPTPGLSGINLTTYVQPGCESPCEPCC

KRTAP3-1

Keratin-associated protein 3-1

98 amino acids

In the wool cortex, wool keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant wool shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of wool keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the KRTAP type 3 family.

10.42 kDa

MACCAPRCCSVRTGPATTICSSDKFCRCGVCLPSTCPHNISLLQPTCCDNSPVPCVYPDTYVPTCFLLNSSHPTPGLSGINLTTFIQPGCENVCEPRC

KRTAP3-1

Keratin-associated protein 3-1

98 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins (By similarity).

Belongs to the KRTAP type 3 family.

10.408 kDa

MAYCAPYCCSVPTGPATTICSSDKFCRCGVCLPSTCPHEISLLQPTCCDNCPPPCCVPDTYVPTCWLLNSSHPTPGLSGINLTTFVQPGCDNVCEPRC

KRTAP3-1

Keratin-associated protein 3-1

98 amino acids

In the wool cortex, wool keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant wool shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of wool keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the KRTAP type 3 family.

10.471 kDa

MACCAPRCCSVRTGPATTICSSDQFCRCGVCLPSTCPHDISLLQPTFCDNSPVPYHVPDTYVPTCFLLNSSHPTPGLSGINLTTFIQPGCENACEPRC

KRTAP3-1

Keratin-associated protein 3-1

98 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the KRTAP type 3 family.

10.539 kDa

MYCCALRSCSVPTGPATTFCSFDKSCRCGVCLPSTCPHEISLLQPICCDTCPPPCCKPDTYVPTCWLLNNCHPTPGLSGINLTTYVQPGCESPCEPRC

Krtap3-1

Keratin-associated protein 3-1

98 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins (By similarity).

Belongs to the KRTAP type 3 family.

10.271 kDa

MACCVARCCSVPTGPATTICSSDKSCRCGVCLPSTCPHEISLLQPTCCDPCPPPCCQPEVYVPTCWLLNSCHPTPGLSGINLTTYVQPGCESPCEPCC

KRTAP3-1

Keratin-associated protein 3-1

98 amino acids

In the wool cortex, wool keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant wool shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of wool keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the KRTAP type 3 family.

10.42 kDa

MACCAPRCCSVRTGPATTICSSDKFCRCGVCLPSTCPHNISLLQPTCCDNSPVPCVYPDTYVPTCFLLNSSHPTPGLSGINLTTFIQPGCENVCEPRC