Krtap15-1

Keratin-associated protein 15-1

150 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

16.242 kDa

MSYTCNSGNYSSQSFGGFLRQPVSTYNSFYPTSNVVYSPKNFQLGSSFYNGQQETFSEPLEGHLPCVGSASFHTSCFRPKQYFSSPCQGGFTGSFGYGNTGFGAFGFGSSGIRSQGCGSNFYRPGYFSSKSIQSSYYQPGYSSGFCGSNF

KRTAP15-1

Keratin-associated protein 15-1

137 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

14.979 kDa

MSYNCSSGNFSSCCFGSYLRYPVSTYNLFYPSNAIYSPNTCQLGSSLYNGCQETYCEPTSCQTSCTLARSYQTSCYCPKNSIFCSPRQTNYIRSLGCGNTGLGSLGCGSTGFQSLDCGSSFYHPTTFSSRNFQATCY

KRTAP15-1

Keratin-associated protein 15-1

136 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

14.608 kDa

MSFNCSTGNFSRSLGGYLGVPVSTCDSFYPSNVVYSPSTFQLGSTLYSDCQENFFRPVSFQTPCAVTRSFQTSCSHPQNFIFRSPCQTIYTGSLGSGNIGLGSFGCGSTGFQSLGCGSNFCSPTYVSSRSCRSSYY