KRTAP13-4

Keratin-associated protein 13-4

160 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

17.755 kDa

MSYNCCSRNFSSRSFGGYLYYPGSYPSSLVYSTALCSPSTCQLRSSLYRDCQKTCWEPASCQKSCYRPRTSILCCPCQTTCSGSLGFRSSSCRSQGYGSRCCYSLGNGSSGFRFLKYGGCGFPSLSYGSRFCYPNYLASGAWQSSCYRPICGSRFYQFTC

KRTAP13-4

Keratin-associated protein 13-4

160 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

17.48 kDa

MSYNCCSRNFSSRSFGGYLYYPGSCPSSLVYSTALCSPSTCQLGSSLYRDCQKTCWEPASCQKSCYHPRTSMLCCPCQTTCSGSLGFGSSSCRSQGYGSRSCYSLGNGSSGFRFLKYGGCGFPSLSYGSRFCYPNYLASGAWQSSCYRPICGSRFYQFTC

KRTAP13-4

Keratin-associated protein 13-4

160 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

17.48 kDa

MSYNCCSRNFSSRSFGGYLYYPGSCPSSLVYSTALCSPSTCQLGSSLYRDCQKTCWEPASCQKSCYHPRTSMLCCPCQTTCSGSLGFGSSSCRSQGYGSRSCYSLGNGSSGFRFLKYGGCGFPSLSYGSRFCYPNYLASGAWQSSCYRPICGSRFYQFTC

KRTAP13-4

Keratin-associated protein 13-4

160 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

17.755 kDa

MSYNCCSRNFSSRSFGGYLYYPGSYPSSLVYSTALCSPSTCQLRSSLYRDCQKTCWEPASCQKSCYRPRTSILCCPCQTTCSGSLGFRSSSCRSQGYGSRCCYSLGNGSSGFRFLKYGGCGFPSLSYGSRFCYPNYLASGAWQSSCYRPICGSRFYQFTC

KRTAP13-4

Keratin-associated protein 13-4

160 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

17.48 kDa

MSYNCCSRNFSSRSFGGYLYYPGSCPSSLVYSTALCSPSTCQLGSSLYRDCQKTCWEPASCQKSCYHPRTSMLCCPCQTTCSGSLGFGSSSCRSQGYGSRSCYSLGNGSSGFRFLKYGGCGFPSLSYGSRFCYPNYLASGAWQSSCYRPICGSRFYQFTC

KRTAP13-4

Keratin-associated protein 13-4

160 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

17.48 kDa

MSYNCCSRNFSSRSFGGYLYYPGSCPSSLVYSTALCSPSTCQLGSSLYRDCQKTCWEPASCQKSCYHPRTSMLCCPCQTTCSGSLGFGSSSCRSQGYGSRSCYSLGNGSSGFRFLKYGGCGFPSLSYGSRFCYPNYLASGAWQSSCYRPICGSRFYQFTC

KRTAP13-4

Keratin-associated protein 13-4

156 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

17.278 kDa

MSYNCCSGNFSSRSFGGYLHYPGCNPYSTALCSPSICQLGSSLYRNCQKTCWEPTSCRKSCYRRRTSMLCSPCQTTCSRSLGFGSSSCHSQGYGSRSCYSLGSGSSGFRFLKYGGCGFPSLSYGSRFCYPNYLASRAWQSSCYRPICGSRFYQFTC

KRTAP13-4

Keratin-associated protein 13-4

156 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

17.278 kDa

MSYNCCSGNFSSRSFGGYLHYPGCNPYSTALCSPSICQLGSSLYRNCQKTCWEPTSCRKSCYRRRTSMLCSPCQTTCSRSLGFGSSSCHSQGYGSRSCYSLGSGSSGFRFLKYGGCGFPSLSYGSRFCYPNYLASRAWQSSCYRPICGSRFYQFTC

KRTAP13-4

Keratin-associated protein 13-4

156 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

17.278 kDa

MSYNCCSGNFSSRSFGGYLHYPGCNPYSTALCSPSICQLGSSLYRNCQKTCWEPTSCRKSCYRRRTSMLCSPCQTTCSRSLGFGSSSCHSQGYGSRSCYSLGSGSSGFRFLKYGGCGFPSLSYGSRFCYPNYLASRAWQSSCYRPICGSRFYQFTC

KRTAP13-4

Keratin-associated protein 13-4

156 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

17.278 kDa

MSYNCCSGNFSSRSFGGYLHYPGCNPYSTALCSPSICQLGSSLYRNCQKTCWEPTSCRKSCYRRRTSMLCSPCQTTCSRSLGFGSSSCHSQGYGSRSCYSLGSGSSGFRFLKYGGCGFPSLSYGSRFCYPNYLASRAWQSSCYRPICGSRFYQFTC

KRTAP13-4

Keratin-associated protein 13-4

156 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

17.278 kDa

MSYNCCSGNFSSRSFGGYLHYPGCNPYSTALCSPSICQLGSSLYRNCQKTCWEPTSCRKSCYRRRTSMLCSPCQTTCSRSLGFGSSSCHSQGYGSRSCYSLGSGSSGFRFLKYGGCGFPSLSYGSRFCYPNYLASRAWQSSCYRPICGSRFYQFTC

KRTAP13-4

Keratin-associated protein 13-4

156 amino acids

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Belongs to the PMG family.

17.278 kDa

MSYNCCSGNFSSRSFGGYLHYPGCNPYSTALCSPSICQLGSSLYRNCQKTCWEPTSCRKSCYRRRTSMLCSPCQTTCSRSLGFGSSSCHSQGYGSRSCYSLGSGSSGFRFLKYGGCGFPSLSYGSRFCYPNYLASRAWQSSCYRPICGSRFYQFTC