krp1

Dibasic-processing endoprotease

709 amino acids

Membrane-bound, subtilisin-like serine protease that processes the P-factor precursor and other precursor proteins. Essential for cell viability. Cleaves substrate on the C-terminal side of dibasic residues.

Belongs to the peptidase S8 family. Furin subfamily.

78.127 kDa

MHPALLCGPILAIFLQFLVSSCSPLENDDLFLVQVEPEVDPVVAAEAIGAKYVRPLLNLKYHHLIKLHKGSDDSVQSSIRKRGIDAGILELERQTPRWRYKRDASESDELLNEFSNHFGISDPLFYGQWHIFNSNNPGHDLNLREVWDAGYFGENVTVAFVDDGIDFKHPDLQAAYTSLGSWDFNDNIADPLPKLSDDQHGTRCAGEVAAAWNDVCGVGIAPRAKVAGLRILSAPITDAVESEALNYGFQTNHIYSCSWGPADDGRAMDAPNTATRRALMNGVLNGRNGLGSIFVFASGNGGHYHDNCNFDGYTNSIFSATIGAVDAEHKIPFYSEVCAAQLVSAYSSGSHLSILTTNPEGTCTRSHGGTSAAAPLASAVYALALSIRPDLSWRDIQHITVYSASPFDSPSQNAEWQKTPAGFQFSHHFGFGKLDASKFVEVAKDWQVVNPQTWLIAPEINVNKSFGSVNNETITEMVSEFTVTKDMIEKSNFKRLEHVTVRVCIPFNRRGALEILLESPSGIRSILASERPYDENSKGFLDWTFMTVQHWAEPPEGVWKLLVNDRSGGKHEGTFENWQLALWGESENPSNTAPLPYDTLELPKEMVLGIYSEPNSDLTNSSTLLSPTSTSFTSYTVSATATPTSTSHIPIPTVLPPTQPVLEPSYREIVAFITFFLLFAFIFVAVIWTWISAFWKAKAPPPLSQQEIA

krp1

Dibasic-processing endoprotease

709 amino acids

Membrane-bound, subtilisin-like serine protease that processes the P-factor precursor and other precursor proteins. Essential for cell viability. Cleaves substrate on the C-terminal side of dibasic residues.

Belongs to the peptidase S8 family. Furin subfamily.

78.127 kDa

MHPALLCGPILAIFLQFLVSSCSPLENDDLFLVQVEPEVDPVVAAEAIGAKYVRPLLNLKYHHLIKLHKGSDDSVQSSIRKRGIDAGILELERQTPRWRYKRDASESDELLNEFSNHFGISDPLFYGQWHIFNSNNPGHDLNLREVWDAGYFGENVTVAFVDDGIDFKHPDLQAAYTSLGSWDFNDNIADPLPKLSDDQHGTRCAGEVAAAWNDVCGVGIAPRAKVAGLRILSAPITDAVESEALNYGFQTNHIYSCSWGPADDGRAMDAPNTATRRALMNGVLNGRNGLGSIFVFASGNGGHYHDNCNFDGYTNSIFSATIGAVDAEHKIPFYSEVCAAQLVSAYSSGSHLSILTTNPEGTCTRSHGGTSAAAPLASAVYALALSIRPDLSWRDIQHITVYSASPFDSPSQNAEWQKTPAGFQFSHHFGFGKLDASKFVEVAKDWQVVNPQTWLIAPEINVNKSFGSVNNETITEMVSEFTVTKDMIEKSNFKRLEHVTVRVCIPFNRRGALEILLESPSGIRSILASERPYDENSKGFLDWTFMTVQHWAEPPEGVWKLLVNDRSGGKHEGTFENWQLALWGESENPSNTAPLPYDTLELPKEMVLGIYSEPNSDLTNSSTLLSPTSTSFTSYTVSATATPTSTSHIPIPTVLPPTQPVLEPSYREIVAFITFFLLFAFIFVAVIWTWISAFWKAKAPPPLSQQEIA

KRP1

Cyclin-dependent kinase inhibitor 1

262 amino acids

Belongs to the CDI family. ICK/KRP subfamily.

27.138 kDa

MGKYMRKFRGATGEELAAMEVTQVVGVRTRSRSAAAAGATTTKVQAASAASTRRRKALLPTAVVGTTRRDGGSCYLQLRSRMLFMAPPRPAPAARAPVVAEAAGSGNGAAAHAAAGLSRCSSTASSVDAAAQDRSLACRSDVAEAGSEHVPEGSASDSASGRDRERRETTPSSFLPGEVSDLESDLAGGQKRSRPLPSAATASAQQATRPKIPPAAEIEAFFAAAEEAEAKRFAAKYNFDVVRGVPLDAGRFEWTPVVSSRS

KRP1

Cyclin-dependent kinase inhibitor 1

262 amino acids

Regulates the production of endosperm cells, affecting seed filling and embryo development. Regulates endoreduplication of endosperm cells. May play a role in the exit from the mitotic cell cycle during rice grain formation. Inhibitis leaf elongation rates by decreasing cell number, that is partly compensated by increased cell size. May not affect growth rate or cell size of the primary root.

Belongs to the CDI family. ICK/KRP subfamily.

27.138 kDa

MGKYMRKFRGATGEELAAMEVTQVVGVRTRSRSAAAAGATTTKVKAASAASTRRRKALLPTAVVGTTRRDGGSCYLQLRSRMLFMAPPRPAPAARAPVVAEAAGSGNGAAAHAAAGLSRCSSTASSVDAAAQDRSLACRSDVAEAGSEHVPEGSASDSASGRDRERRETTPSSFLPGEVSDLESDLAGGQKRSRPLPSAATASAQQATRPKIPPAAEIEAFFAAAEEAEAKRFAAKYNFDVVRGVPLDAGRFEWTPVVSSRS

KRP1

Cyclin-dependent kinase inhibitor 1

262 amino acids

Belongs to the CDI family. ICK/KRP subfamily.

27.138 kDa

MGKYMRKFRGATGEELAAMEVTQVVGVRTRSRSAAAAGATTTKVQAASAASTRRRKALLPTAVVGTTRRDGGSCYLQLRSRMLFMAPPRPAPAARAPVVAEAAGSGNGAAAHAAAGLSRCSSTASSVDAAAQDRSLACRSDVAEAGSEHVPEGSASDSASGRDRERRETTPSSFLPGEVSDLESDLAGGQKRSRPLPSAATASAQQATRPKIPPAAEIEAFFAAAEEAEAKRFAAKYNFDVVRGVPLDAGRFEWTPVVSSRS

KRP1

Cyclin-dependent kinase inhibitor 1

262 amino acids

Regulates the production of endosperm cells, affecting seed filling and embryo development. Regulates endoreduplication of endosperm cells. May play a role in the exit from the mitotic cell cycle during rice grain formation. Inhibitis leaf elongation rates by decreasing cell number, that is partly compensated by increased cell size. May not affect growth rate or cell size of the primary root.

Belongs to the CDI family. ICK/KRP subfamily.

27.138 kDa

MGKYMRKFRGATGEELAAMEVTQVVGVRTRSRSAAAAGATTTKVKAASAASTRRRKALLPTAVVGTTRRDGGSCYLQLRSRMLFMAPPRPAPAARAPVVAEAAGSGNGAAAHAAAGLSRCSSTASSVDAAAQDRSLACRSDVAEAGSEHVPEGSASDSASGRDRERRETTPSSFLPGEVSDLESDLAGGQKRSRPLPSAATASAQQATRPKIPPAAEIEAFFAAAEEAEAKRFAAKYNFDVVRGVPLDAGRFEWTPVVSSRS

KRP1

Cyclin-dependent kinase inhibitor 1

191 amino acids

Binds and inhibits CYCD2-1/CDKA-1 kinase complex activity. Regulates cell division which is crucial for plant growth, development and morphogenesis. Functions in turning cells from a mitotic to an endoreplicating cell cycle mode. Acts cell- and non-cell-autonomously to regulate endoreduplication by allowing S phase progression, but blocking entry into mitosis. Keeps on the one hand the plant cell cycle locally controlled, and on the other hand provides a possibility of linking cell cycle control in single cells with the supracellular organization of a tissue or an organ. May target specifically CDKA-1.

Belongs to the CDI family. ICK/KRP subfamily.

22.283 kDa

MVRKYRKAKGIVEAGVSSTYMQLRSRRIVYVRSEKSSSVSVVGDNGVSSSCSGSNEYKKKELIHLEEEDKDGDTETSTYRRGTKRKLFENLREEEKEELSKSMENYSSEFESAVKESLDCCCSGRKTMEETVTAEEEEKAKLMTEMPTESEIEDFFVEAEKQLKEKFKKKYNFDFEKEKPLEGRYEWVKLE

KRP1

Cyclin-dependent kinase inhibitor 1

191 amino acids

Binds and inhibits CYCD2-1/CDKA-1 kinase complex activity. Regulates cell division which is crucial for plant growth, development and morphogenesis. Functions in turning cells from a mitotic to an endoreplicating cell cycle mode. Acts cell- and non-cell-autonomously to regulate endoreduplication by allowing S phase progression, but blocking entry into mitosis. Keeps on the one hand the plant cell cycle locally controlled, and on the other hand provides a possibility of linking cell cycle control in single cells with the supracellular organization of a tissue or an organ. May target specifically CDKA-1.

Belongs to the CDI family. ICK/KRP subfamily.

22.283 kDa

MVRKYRKAKGIVEAGVSSTYMQLRSRRIVYVRSEKSSSVSVVGDNGVSSSCSGSNEYKKKELIHLEEEDKDGDTETSTYRRGTKRKLFENLREEEKEELSKSMENYSSEFESAVKESLDCCCSGRKTMEETVTAEEEEKAKLMTEMPTESEIEDFFVEAEKQLKEKFKKKYNFDFEKEKPLEGRYEWVKLE

KRP1

Calcium-binding protein KRP1

130 amino acids

Potential calcium sensor that binds calcium in vitro.

14.503 kDa

MASPKSPTRPTQQNPQPNFHDFLPTMAGNLGGEGLIGELCNGFELLMDREKGVITFESLRRNAAAVLGLGDLTDEDVRCMIKEGDFDCDGALNQMEFCVLMFRLSPDLMEASRCLVTEVIEEEFGFTRRH