About Products Protein Database Contact

KOM

Gene
KOM
Protein
RHOMBOID-like protein 8
Organism
Arabidopsis thaliana
Length
351 amino acids
Function
Probably essential for the meiosis stage-specific callose accumulation and pollen exine formation.
Similarity
Belongs to the peptidase S54 family.
Mass
39.315 kDa
Sequence
MEVPTESKTTQIDEISHNLSFTTSNAGDSSWDKISFFRHRSRQIKRDTWLVSVFVLLQIVLFAVTMGVNDCSGNSHGHCSAKLLGRFSFQSLSENPMLGPSASTLEHMGGLSWKALTENHEIWRILTSPWLHSGLFHLFINLGSLIFVGIYMEQQFGPLRIAVIYFLSGIMGSLFAVLFVRNIPSISSGAAFFGLIGAMLSALAKNWNLYNSKISALAIIFTIFTVNFLIGFLPFIDNFANIGGFISGFLLGFVLLFKPQLRQMPPSHKGKLFEDDMNRSTRLKEQFDRPVLRIICLLVFCGILAGVLLAACWGVNLNRHCHWCRYVDCVPTKKWSCSDMTTSCEVYSSKP