KIN28

Probable serine/threonine-protein kinase KIN28 homolog

308 amino acids

Protein kinase component of transcription factor IIH (TFIIH) which phosphorylates the C-terminal domain of RNA polymerase II during transition from transcription to elongation after preinitiation complex (PIC) formation, thereby positively regulating transcription. Essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

34.949 kDa

MKTYIRERRLGEGTYAVIYLGYRALPQDKPLVSSGTRIEDVPVAIKKIKPTKYTQGHEISAIREIKSLKRIDSKYVVRLIDTFVYDKCVHIVLEYVETNLENVIRNSDKIIMPGDIKAWILMVLRGVYECHRLFIIHRDIKPNNILITSEGMVKLADFGLTRGIGNRMTPQAVTRWYRAPELLMGSRDYGSPVDMWSVGCVFAELFLRVPLFAGDTDIQQLDMIFRALGTPVEREWPGVSTLPEFLDFQQYPKASLNGLFSAASSDALDLLEKLLTLNPCNRISCDDAIKHPYFKSSPPPTPIGKLPV

KIN28

Serine/threonine-protein kinase KIN28

306 amino acids

Catalytic component of the TFIIK complex (KIN28-CCL1 dimer) which is the protein kinase component of transcription factor IIH (TFIIH) and phosphorylates the C-terminal domain of RNA polymerase II during transition from transcription to elongation after preinitiation complex (PIC) formation, thereby positively regulating transcription. TFIIH (or factor B) is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has DNA-dependent ATPase activity and is essential for polymerase II transcription in vitro. Essential for cell proliferation.

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

35.247 kDa

MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDPSSIKIRN