KDELR2

ER lumen protein-retaining receptor 2

212 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum (By similarity). Binding is pH dependent, and is optimal at pH 5-5.4 (By similarity).

Belongs to the ERD2 family.

24.454 kDa

MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA

KDELR2

ER lumen protein-retaining receptor 2

212 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum (By similarity). Binding is pH dependent, and is optimal at pH 5-5.4 (PubMed:30846601).

Belongs to the ERD2 family.

24.456 kDa

MNIFRLTGDLSHLAAIIILLLKIWKSRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLIVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRYYFEGFFDLIAVVAGVVQTVLYCDFFYLYVTKVLKGKKLSLPA

kdelr2

ER lumen protein-retaining receptor 2

212 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum (By similarity). Binding is pH dependent, and is optimal at pH 5-5.4 (By similarity).

Belongs to the ERD2 family.

24.324 kDa

MNIFRLTGDLSHLAAIIILLLKIWKSRSCAGISGKSQILFALVFTTRYLDLLTSFISLYNTCMKVIYIGCAYATVYLIYAKFRATYDGNHDTFRAEFLVVPVGGLAFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFCLGVYRALYLFNWIWRFYFEGFFDMIAIVAGVVQTILYCDFFYLYVTKVLKGKKLSLPA

KDELR2

ER lumen protein-retaining receptor 2

212 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum (PubMed:1325562, PubMed:18086916). Binding is pH dependent, and is optimal at pH 5-5.4 (By similarity).

Belongs to the ERD2 family.

24.422 kDa

MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLACSYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA

Kdelr2

ER lumen protein-retaining receptor 2

212 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum (By similarity). Binding is pH dependent, and is optimal at pH 5-5.4 (By similarity).

Belongs to the ERD2 family.

24.454 kDa

MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA

Kdelr2

ER lumen protein-retaining receptor 2

212 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum (By similarity). Binding is pH dependent, and is optimal at pH 5-5.4 (By similarity).

Belongs to the ERD2 family.

24.454 kDa

MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA

kdelr2

ER lumen protein-retaining receptor 2

212 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum (By similarity). Binding is pH dependent, and is optimal at pH 5-5.4 (By similarity).

Belongs to the ERD2 family.

24.344 kDa

MNVFRLSGDLCHLAAIIILLLKIWNSRSCAGISGKSQLLFAMVFTTRYLDLFTSFISLYNTSMKVIYMGCAYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSVLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLFNWIWRFSFEGFFDLIAIVAGVVQTILYCDFFYLYVTKVLKGKKLSLPA

kdelr2

ER lumen protein-retaining receptor 2

212 amino acids

Receptor for the C-terminal sequence motif K-D-E-L that is present on endoplasmic reticulum resident proteins and that mediates their recycling from the Golgi back to the endoplasmic reticulum (By similarity). Binding is pH dependent, and is optimal at pH 5-5.4 (By similarity).

Belongs to the ERD2 family.

24.288 kDa

MNVFRLSGDLSHLAAIIILLLKIWKSRSCAGISGKSQLLFALVFTTRYLDLLTSFISLYNTSMKVIYIGCAYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSVLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLFNWIWRYSFEGFFDLIAIVAGVVQTILYCDFFYLYVTKVLKGKKLSLPA