KCNMB1

Putative calcium-activated potassium channel subunit beta

200 amino acids

Probable regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel that modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel (By similarity).

Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB1 subfamily.

22.678 kDa

MLAKKLVTAQKRGETRALCLGLGMVACSMMMYFFIGITIVPFYTKSVWTTETICKVLKANIKDKTHCTNSEGSEDEDIFHYPCLQVWVNLTASGQEVMLYHTEDTLERNPKCSYVPGNSENSKEVKARIETIASNFKKYQTFPCYYDPGGMQTNVILSRLYPPKGLLFTFLWPTLMFTGGCLIIVLVKISQYFSVLSARQ

KCNMB1

Calcium-activated potassium channel subunit beta-1

191 amino acids

Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate.

Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB1 subfamily.

21.797 kDa

MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADVEKVRAKFQEQQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKSNQYLSILAAQK

Kcnmb1

Calcium-activated potassium channel subunit beta-1

191 amino acids

Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate.

Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB1 subfamily.

21.846 kDa

MGKKLVMAQKRGETRALCLGVAMVVCAAITYYVLGTTVLPLYQKSVWTQESICHLIETNIKDQEELEGKKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALADVKKVRANFYKHHEFYCLSAPQVNETSVVYQRLYGPQVLLFSFFWPTFLLTGGLLLIAMVKLNRSLSILAAQK

KCNMB1

Calcium-activated potassium channel subunit beta-1

191 amino acids

Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate (By similarity).

Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB1 subfamily.

21.829 kDa

MGKKLVMAQKRGETRALCLGVAMVMCAVITYYILGTTMLPLYQKSVWTQESLCRLIETNIRDQEELEGKKVPQYPCLWVNVSAVGKWAVLYHTEETRDRNQQCSYIPGSLDNYQMALADVEKVRAKFHERQVFYCFSTTQENETSVLYQRLYGPQALLASLFWPTFLLTGGLLIIAMVKINRSLSILAAQK

Kcnmb1

Calcium-activated potassium channel subunit beta-1

191 amino acids

Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate (By similarity).

Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB1 subfamily.

21.909 kDa

MGKKLVMAQKRGETRALCLGVAMVVCAAITYYILGTTVLPLYQKSVWTQESTCHLVETNIKDQEELEGRKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALVDVKKVRANFYKHHNFYCFSAPQVNETSVVYQRLYGPQILLFSFFWPTFLLTGGLLIIAMVKLNRSLSVLAAQK

KCNMB1

Calcium-activated potassium channel subunit beta-1

191 amino acids

Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate (By similarity).

Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB1 subfamily.

21.957 kDa

MGKKLVMAQRRGETRALCLGVAMVVGAVITYYILGTTVLPLYQKSVWTQESTCHLIETNIRDQEELEGKRVPQYPCLWVNVSSVGRWAVLYHTEDTRDQNHQCSYIPSSLDNYQVARADVEKVRARFHENQDFFCFSTTRENETSVLYRRLYGPQSLLFSLFWPTFLLTGGLLIIVMVKINQSLSILAAQR

KCNMB1

Calcium-activated potassium channel subunit beta-1

191 amino acids

Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate (By similarity).

Belongs to the KCNMB (TC 8.A.14.1) family. KCNMB1 subfamily.

21.935 kDa

MGKKLVMAQKRGETRALCLGVAMVMCAVIAYYILGTTMLPLYQKSVWTQKSTCHLIETNIREQEELEGKKVPQYPCLWVNVSAVGRWAVLYHTEDTRDQNHQCSYIPGSLENYQVARADVEKVKAKFHEQQIFYCFSTTRENETTVLYRRLYGPQTLLFSLFWPTFLLTGGLLIIAMVKINQSLSILAAQR