katnb1

Katanin p80 WD40 repeat-containing subunit B1

694 amino acids

Participates in a complex which severs microtubules in an ATP-dependent manner. May act to target the enzymatic subunit of this complex to sites of action such as the centrosome. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation.

Belongs to the WD repeat KATNB1 family.

75.995 kDa

MALTNTTITSWKLQEIVAHSSNVSSLVLGKSSGRLLATGGEDCRVNIWAVSKPNCIMSLTGHTSAVGCIQFNSSEERVVAGSLSGSLRLWDLEAAKILRTLMGHKASISSLDFHPMGEYLASGSVDSNIKLWDVRRKGCVFRYKGHTQAVRCLAFSPDGKWLASASDDSTVKLWDLIAGKMITEFTSHTSAVNVVQFHPNEYLLASGSADRTVKLWDLEKFNMIGSSEGETGVVRSVLFNPDGSCLYSGSENTLRVYGWEPDRCFDVVHVGWGKVSDLAISNNQMIAVSYSHTNVSWYVVDLNRVKKSGSVIQGLIQDKPIPAPSSALGTTLRRNYERPTTSCTGQEMKQSSEADRRSPEGERRSPSSEDEKEDKESSAEITNPEDYKEIFQPRSVISRTPPKTTEPFPAPLEHSFSESVLEKPGPVVKIVTPVIDRAGQLKGPITSSTPVQRVEPTVIAAAPRPVAVVTTSASSPSRPVVNTTKPKPSTGIILSTRNEPIGLNAGDFLSHARNAKASAMGDEEALAQIRKGHDTMCVMLSSRSKNLDSVRSVWASGDVKTSLDSAVSMNDLSIVVDVLNIINLKPSLWKLDLCTSILPQIEELLQSRYESYVQTGCMSLKLILKRFWPLISDTLNAPPSVGVDITREERHQKCKACYKQLKNLSNVVKNRAEQVGRHGSTFRELQLLMAPLDY

KATNB1

Katanin p80 WD40 repeat-containing subunit B1

690 amino acids

Participates in a complex which severs microtubules in an ATP-dependent manner. May act to target the enzymatic subunit of this complex to sites of action such as the centrosome. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation.

Belongs to the WD repeat KATNB1 family.

75.814 kDa

MATKRAWKLQELVAHSSNVNCLALGPMSGRVMVTGGEDKKVNLWAVGKQNCIISLSGHTSPVDSVKFNSSEELVVAGSQSGTMKIYDLEPAKIVRTLTGHRNSIRCMDFHPFGEFVASGSTDTNVKLWDVRRKGCIYTYKGHSDQVNMIKFSPDGKWLVTASEDTTIKLWDLTMGKLFQEFKNHTGGVTGIEFHPNEFLLASGSSDRTVQFWDLETFQLVSSTSPGASAVRSISFHPDGSYLFCSSQDMLHAFGWEPIRCFDTFSVGWGKVADTVIASTQLIGASFNATNVSVYVADLSRMSTTGIAQEPQSQPSKTPSGGAEEVPSKPLTASGRKNFVRERPHTTSSKQRQPDVKSEPERQSPTQDEGVKDDDATDIKDPDSYAKIFSPKTRVDHSPERNAQPFPAPLDVPGAQEPEPFKHPPKPAAAAAVAPVSRAPAPSASDWQPAQANPAPNRVPAATKPVPAQEVAPSRKPDPISTIIPSDRNKPANLDMDAFLPPAHAQQAPRVNAPASRKQSDSERIEGLRKGHDSMCQVLSSRHRNLDVVRAIWTAGDAKTSVESVVNMKDQAILVDILNIMLLKKSLWNLDMCVVVLPRLKELLSSKYENYVHTSCACLKLILKNFTSLFNQNIKCPPSGIDITREERYNKCSKCYSYLIATRGYVEEKQHVSGKLGSSFRELHLLLDQLE

Katnb1

Katanin p80 WD40 repeat-containing subunit B1

658 amino acids

Participates in a complex which severs microtubules in an ATP-dependent manner. May act to target the enzymatic subunit of this complex to sites of action such as the centrosome. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Microtubule release from the mitotic spindle poles may allow depolymerization of the microtubule end proximal to the spindle pole, leading to poleward microtubule flux and poleward motion of chromosome. The function in regulating microtubule dynamics at spindle poles seems to depend on the association of the katanin KATNA1:KATNB1 complex with ASPM which recruits it to microtubules. Reversely KATNA1:KATNB1 can enhance ASPM blocking activity on microtubule minus-end growth. Microtubule release within the cell body of neurons may be required for their transport into neuronal processes by microtubule-dependent motor proteins. This transport is required for axonal growth.

Belongs to the WD repeat KATNB1 family.

72.639 kDa

MATPVVTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQDSLRVYGWEPERCFDVVLVNWGKVADLAICNDQLIGVAFSQSNVSSYVVDLTRVTRTGTVTQDPVQANQPLTQQTPNPGVSLRRIYERPSTTCSKPQRVKHNSESERRSPSSEDDRDERESRAEIQNAEDYNEIFQPKNSISRTPPRRSEPFPAPPEDDAATVKEVSKPSPAMDVQLPQLPVPNLEVPARPSVMTSTPAPKGEPDIIPATRNEPIGLKASDFLPAVKVPQQAELVDEDAMSQIRKGHDTMFVVLTSRHKNLDTVRAVWTTGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDILAAPPSVGVDISREERLHKCRLCFKQLKSISGLVKSKSGLSGRHGSAFRELHLLMASLD

KATNB1

Katanin p80 WD40 repeat-containing subunit B1

657 amino acids

Participates in a complex which severs microtubules in an ATP-dependent manner. May act to target the enzymatic subunit of this complex to sites of action such as the centrosome. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation.

Belongs to the WD repeat KATNB1 family.

72.738 kDa

MAAAVVTKTAWKLQEIVAHSSNVSSLVLGKSTGRLLATGGDDCRVNVWSVNKPNCVMSLTGHTTPIESLQISAKEELIVAGSQSGSIRVWDLEAAKILRTLLGHKANICSLDFHPYGSFVASGSLDTDIKLWDVRRKGCIFKYKSHTQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKVMFEFTGHSGPVNVVEFHPSEYLLASGSSDRTIRFWDLEKFHVVSCIEEEATPVRCILFNPDGCCLYGGFQDSLRVYGWEPERCFDVVVVNWGKVADLSVCHNQLIGVSFAQSTVSSFVVDLSRVTKSGSVPHGLLRNNELLAQPTPTGSSLRRSYDRPSTSCSKPQRVKHSSESERRSPSSEEDRDEKESKAEIQNPEDYKEIFQPRNAISRTPPHINEPFPAPPEDEPITAKEAVKPNQPVEVQTPLPKQELPETFQRPPIASSTPMPRAEPSVIPAARNEPIGLKASDFLPALKNQSQAELTDEEIMSQIRKGHKTVCMVLTSRHKNLDTVRAVWSTSDMKNSVDAAVATNDLSVVVDLLNIVNQTASLWKLDLCTVVLPQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDILAAPPSVGVDITREERLHKCRLCYKQLKNISNIVKNKSGLSGRHGSAFRELHLLMAVLE

KATNB1

Katanin p80 WD40 repeat-containing subunit B1

655 amino acids

Participates in a complex which severs microtubules in an ATP-dependent manner. May act to target the enzymatic subunit of this complex to sites of action such as the centrosome. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Microtubule release from the mitotic spindle poles may allow depolymerization of the microtubule end proximal to the spindle pole, leading to poleward microtubule flux and poleward motion of chromosome. Microtubule release within the cell body of neurons may be required for their transport into neuronal processes by microtubule-dependent motor proteins. This transport is required for axonal growth.

Belongs to the WD repeat KATNB1 family.

72.334 kDa

MATPVVTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQDSLRVYGWEPERCFDVVLVNWGKVADLAICNDQLIGVAFSQSNVSSYVVDLTRVTRTGTVARDPVQDHRPLAQPLPNPSAPLRRIYERPSTTCSKPQRVKQNSESERRSPSSEDDRDERESRAEIQNAEDYNEIFQPKNSISRTPPRRSEPFPAPPEDDAATAKEAAKPSPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCVVLTSRHKNLDTVRAVWTMGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKYESYVQTGCTSLKLILQRFLPLITDMLAAPPSVGVDISREERLHKCRLCYKQLKSISGLVKSKSGLSGRHGSTFRELHLLMASLD

katnb1

Katanin p80 WD40 repeat-containing subunit B1

655 amino acids

Participates in a complex which severs microtubules in an ATP-dependent manner. May act to target the enzymatic subunit of this complex to sites of action such as the centrosome. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation.

Belongs to the WD repeat KATNB1 family.

71.593 kDa

MAAPSPTKTTWKLQEIVAHGCSVSSVVLGRSSGRLVATGGDDCRVHLWSVNKPNCIMSLTGHTTPVESVRFNNSEELIVAGSQSGSLRIWDLEAAKILRTLMGHKANVSSLDFHPYGEFVASGSLDTNIKLWDVRRKGCVFRYKGHTQAVRCLRFSPDGKWLASASDDHSVKLWDLTAGKMMAELSEHKGPVNIIEFHPNEYLLASGSADRTVRFWDLEKFQLVGCTEGETIPVRAILFSNDGGCIFCGGKDSLRVYGWEPDQCFDTVPVGWGKVSDLAICNNQLIGVSSAQSNISSFVVDLTRVKMTGCAPQGPVPAEIPISQPAPTGTSLRRIYERPSTTCSKPNRVSPTSDDEEKESRAEIQNPEDYKEIFQPKNAISRTPPRNSEPFPAPPEDDISIVKEAVAPTPDVVTPATSNKKNTEQLQRPPVAASTPIVCQEPSPVPAPQSKPPVISAARNEPIGLKAADFLPAVKSSSPTEVVDDEAVSQIRKGHDTMCMVLTSRMRNLDTVRAVWSSGDIKTSIDSAVAINDLSVVVDLLNIINQKASLWKLDLCMTVLPQIEKMLQSKYESYVQTGCISLKLILQRFLPLITDILAAPPSVGVDISREERLSKCKLCYKQLRILSPLVKSKASQSGRYGSAFRELHLLMSGLE

katnb1

Katanin p80 WD40 repeat-containing subunit B1

655 amino acids

Participates in a complex which severs microtubules in an ATP-dependent manner. May act to target the enzymatic subunit of this complex to sites of action such as the centrosome. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation.

Belongs to the WD repeat KATNB1 family.

71.568 kDa

MATPSPTKTTWKLQEIVAHGSSVSSVVLGKSSGRLVATGGDDCRVNLWSVNKPNCIMSLTGHTTPVESVRFNNAEELIVAGSQSGSLRVWDLEAAKILRTLMGHKANVCSLDFHPYGDFVASGSLDTNIKLWDVRRKGCVFRYKGHTQAVRCLRFSPDGKWLASASDDHSVKLWDLTAGKMMAELSEHKGPVNIIEFHPNEYLLASGSADRTVRFWDLEKFQLIGCTEGETIPVRAILFSSDGGCIFCGGRDALRVYGWEPDQCFDTVPVGWGKVCDLAICNKQLIGVSSAQSTISSFVVDLTRVKMTGCAPQGPVPAEMPISQPAPAGTSLRRIYERPSTTCSKPKRVSPTSDDEEKESRAEIQNPEDYKEIFQPKNAISRTPPRNSEPFPAPPEDDTSILKEPVAPIPDVVTPATSNKNNTEQLQRPPVAASTPIVCQEPSPVPAPQSKPPVISAARNEPIGLKAADFLPAVKTSSPTEVVDDEAVSQIRKGHDTMCMVLTSRMRNLDTVRAVWSSGDIKTSIDSAVAINDLSVVVDLLNIINQKASLWKLDLCLTVLPQIEKMLQSKYESYVQTGCISLKLILQRFLPLITDILAAPPSVGVDISREERLSKCKLCYKQLRILSPLVKSKASQSGRYGSAFRELHLLMSGLE