JAGN1

Protein jagunal homolog 1

183 amino acids

Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function. Required for vesicle-mediated transport; it is however unclear whether it is involved in early secretory pathway or intracellular protein transport. Acts as a regulator of neutrophil function, probably via its role in vesicle-mediated transport: required for defense against fungal pathogens and for granulocyte colony-stimulating factor (GM-CSF) signaling pathway; possibly by regulating glycosylation and/or targeting of proteins contributing to the viability and migration of neutrophils.

Belongs to the jagunal family.

21.102 kDa

MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAMPYQWEYPYLLSVVPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLFGFSAVSVMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKRK

JAGN1

Protein jagunal homolog 1

183 amino acids

Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function. Required for vesicle-mediated transport; it is however unclear whether it is involved in early secretory pathway or intracellular protein transport. Acts as a regulator of neutrophil function, probably via its role in vesicle-mediated transport: required for defense against fungal pathogens and for granulocyte colony-stimulating factor (GM-CSF) signaling pathway; possibly by regulating glycosylation and/or targeting of proteins contributing to the viability and migration of neutrophils.

Belongs to the jagunal family.

21.125 kDa

MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAMPYQWEYPYLLSILPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLFGFSAVSIMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKHK

Jagn1

Protein jagunal homolog 1

183 amino acids

Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function. Required for vesicle-mediated transport; it is however unclear whether it is involved in early secretory pathway or intracellular protein transport. Acts as a regulator of neutrophil function, probably via its role in vesicle-mediated transport: required for defense against fungal pathogens and for granulocyte colony-stimulating factor (GM-CSF) signaling pathway; possibly by regulating glycosylation and/or targeting of proteins contributing to the viability and migration of neutrophils.

Belongs to the jagunal family.

21.102 kDa

MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAMPYQWEYPYLLSIVPSVLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLFGFSAVSVMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKRK

Jagn1

Protein jagunal homolog 1

183 amino acids

Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function. Required for vesicle-mediated transport; it is however unclear whether it is involved in early secretory pathway or intracellular protein transport. Acts as a regulator of neutrophil function, probably via its role in vesicle-mediated transport: required for defense against fungal pathogens and for granulocyte colony-stimulating factor (GM-CSF) signaling pathway; possibly by regulating glycosylation and/or targeting of proteins contributing to the viability and migration of neutrophils.

Belongs to the jagunal family.

21.102 kDa

MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAMPYQWEYPYLLSIVPSVLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLFGFSAVSVMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKRK

jagn1

Protein jagunal homolog 1

183 amino acids

Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function.

Belongs to the jagunal family.

20.978 kDa

MASRAGPRATGSDGSDFQHREKVAGHYKMSASLKNEIKKLIYAHLIIWMLIAAQMCVSHLKLVSKDLVAMPYQWEYPYLLSLVPSLFGLFSFPRNNISYLVISMISTGLFSIGPLIYGTLEMFPMAQQLYRHGKAYRFIFGFSAISVMYLVMVVAVQVHGWQIYYSKKLLDSWFTNTQEKKKK

jagn1

Protein jagunal homolog 1

183 amino acids

Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function.

Belongs to the jagunal family.

20.982 kDa

MASRAGPRATGTDGSDFQHRERVASHYQMSASLKNEIKKLIYAHLVIWLLIAAQMCVSHLKLVSKDLVAMPYQWEYPYLLSLVPSLFGLVSFPRNNISYLVISMISTGLFSIAPLIYGTLEMFPMAQQLYRHGKAYRFIFGFSAISVMYLLMVVAVQVHGWQIYYSKKLLDAWFTNTQEKKKK

JAGN1

Protein jagunal homolog 1

183 amino acids

Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function. Required for vesicle-mediated transport; it is however unclear whether it is involved in early secretory pathway or intracellular protein transport. Acts as a regulator of neutrophil function, probably via its role in vesicle-mediated transport: required for defense against fungal pathogens and for granulocyte colony-stimulating factor (GM-CSF) signaling pathway; possibly by regulating glycosylation and/or targeting of proteins contributing to the viability and migration of neutrophils.

Belongs to the jagunal family.

21.102 kDa

MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAMPYQWEYPYLLSVVPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLFGFSAVSVMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKRK

JAGN1

Protein jagunal homolog 1

183 amino acids

Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function. Required for vesicle-mediated transport; it is however unclear whether it is involved in early secretory pathway or intracellular protein transport. Acts as a regulator of neutrophil function, probably via its role in vesicle-mediated transport: required for defense against fungal pathogens and for granulocyte colony-stimulating factor (GM-CSF) signaling pathway; possibly by regulating glycosylation and/or targeting of proteins contributing to the viability and migration of neutrophils.

Belongs to the jagunal family.

21.125 kDa

MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAMPYQWEYPYLLSILPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLFGFSAVSIMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKHK

Jagn1

Protein jagunal homolog 1

183 amino acids

Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function. Required for vesicle-mediated transport; it is however unclear whether it is involved in early secretory pathway or intracellular protein transport. Acts as a regulator of neutrophil function, probably via its role in vesicle-mediated transport: required for defense against fungal pathogens and for granulocyte colony-stimulating factor (GM-CSF) signaling pathway; possibly by regulating glycosylation and/or targeting of proteins contributing to the viability and migration of neutrophils.

Belongs to the jagunal family.

21.102 kDa

MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAMPYQWEYPYLLSIVPSVLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLFGFSAVSVMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKRK

Jagn1

Protein jagunal homolog 1

183 amino acids

Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function. Required for vesicle-mediated transport; it is however unclear whether it is involved in early secretory pathway or intracellular protein transport. Acts as a regulator of neutrophil function, probably via its role in vesicle-mediated transport: required for defense against fungal pathogens and for granulocyte colony-stimulating factor (GM-CSF) signaling pathway; possibly by regulating glycosylation and/or targeting of proteins contributing to the viability and migration of neutrophils.

Belongs to the jagunal family.

21.102 kDa

MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAMPYQWEYPYLLSIVPSVLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLFGFSAVSVMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKRK

jagn1

Protein jagunal homolog 1

183 amino acids

Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function.

Belongs to the jagunal family.

20.978 kDa

MASRAGPRATGSDGSDFQHREKVAGHYKMSASLKNEIKKLIYAHLIIWMLIAAQMCVSHLKLVSKDLVAMPYQWEYPYLLSLVPSLFGLFSFPRNNISYLVISMISTGLFSIGPLIYGTLEMFPMAQQLYRHGKAYRFIFGFSAISVMYLVMVVAVQVHGWQIYYSKKLLDSWFTNTQEKKKK

jagn1

Protein jagunal homolog 1

183 amino acids

Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function.

Belongs to the jagunal family.

20.982 kDa

MASRAGPRATGTDGSDFQHRERVASHYQMSASLKNEIKKLIYAHLVIWLLIAAQMCVSHLKLVSKDLVAMPYQWEYPYLLSLVPSLFGLVSFPRNNISYLVISMISTGLFSIAPLIYGTLEMFPMAQQLYRHGKAYRFIFGFSAISVMYLLMVVAVQVHGWQIYYSKKLLDAWFTNTQEKKKK