immp1l

Mitochondrial inner membrane protease subunit 1

167 amino acids

Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space.

Belongs to the peptidase S26 family. IMP1 subfamily.

18.661 kDa

MIRRIVGKTLGLLGYTIQYGCIAHCAFEYIGEVVICSGPSMEPTIRNYDVLLCDNLSRHFFSIHKGDIIVAKSPDKPSVNICKRVIGLEGDKVCMSSPSALLKRHTYVPKGHVWLEGDNLDNSTDSRSYGPVPYALIRGRICLRVWPLESFGPLKESPNGRIQDNWP

Immp1l

Mitochondrial inner membrane protease subunit 1

166 amino acids

Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO (By similarity).

Belongs to the peptidase S26 family. IMP1 subfamily.

18.502 kDa

MLRGVLGKAFRLAGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILSTSPSDVFKSRSYVPTGHVWLEGDNLQNSTDSRYYGPIPYGLIRGRIFFKIWPFSDFGFLRDSPNGQRFSDD

IMMP1L

Mitochondrial inner membrane protease subunit 1

166 amino acids

Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO.

Belongs to the peptidase S26 family. IMP1 subfamily.

18.504 kDa

MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD

IMMP1L

Mitochondrial inner membrane protease subunit 1

166 amino acids

Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO.

Belongs to the peptidase S26 family. IMP1 subfamily.

18.504 kDa

MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD