Function
Acts partially redundantly with other irx members in neural patterning. Required for formation of the posterior forebrain, midbrain, hindbrain, and to a lesser extent, spinal cord. Acts early in neural plate development to induce expression of some but not all proneural genes, and specify a neural precursor state. Also up-regulates repressors that prevent neuronal differentiation. Patterns the neuroectoderm in both the anterior/posterior and dorsal/ventral axes. Probably dispensable for pronephric kidney development.
Sequence
MSYPQGYLYQPPGSLALYSCPAYGASALAAPRSEELARSSSGSAFSPYPGSAAFTAQAATGFSSPLQYSSDPAGFPSYMGSPYDAHTTGMTGALSYHPYGSAAYPYQLNDPAYRKNATRDATATLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSEDEDDDEGDGERVKEEQSEKAQDCNETSAEDEGISLHVDSLTDHSCSADSDGEKLPCRATDHLCESGSESKEKYDDDEDEEEGDEEDRVLPVKPATSSPLTGVEAPILNHQQDGSPRNSNKTSLDNGMSPSSQTPASKPKLWSLAEIATSDHKHSNLGSVLSSATSSAAHNPSYPSSSLLGRHIYYTSPFYSNYTNYGNFNALQSQGILRYSSAAVTANEGLNQTVLSTSSMHKHTSDSVRTASNQLDQHYRPTNFESKKDPSEVCTVGVQPYP