IPL1

Spindle assembly checkpoint kinase

528 amino acids

Required for high-fidelity chromosome segregation during the later part of each cell cycle. Acts in opposition to the phosphatase PP1. Has a role in attaching the kinetochores to the microtubules and ensuring that sister kinetochores connect to opposite poles. The promotion of bi-orientation is achieved by selectively detaching kinetochore-microtubule attachments that are not under tension. Phosphorylates histone H3 to form H3S10ph during mitosis and meiosis (By similarity).

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.

60.193 kDa

MMLPRNSPHRTESTLAYNNNNSNNNNNNNGSSLFQRKPLAPINSEFKISKPQHIKPTTHSHTFTTPTPKTRNTATTTTNNNNRNNHQYRNPNLNTSLVFTPTKNSSSSSSSHSSSLLSSSPFVEEPENQPESNHTRATSHYRTTSTSQYKSSANKDASHSLITSSKRKTSTKQTSESTNPKRRTTTTATQNTNNNKILNPSLSSSTIRFSTVSSSTSSSTTSSSSSSHTSPKPQQQLTLDDFEFGKILGKGKLGRVYCVKHKQSGLIFALKVMSKSEIMNLKLEKSLRREIEIQSNLYHINITRLYSWFHDSINIYLLLEYSIEGELYTHLKKLKRFDNIMASNYIFQITQALIFLHQRGIIHRDLKPENIMVSLDNQLKLSDFGWSVQINQNQNQNQIHNQTQTQKTPHQKKQKQKRLTICGTLDYLPPEMIESKSHDFSVDIWALGILCYELLVGKPPFEAINRNITYEKIAKVDIKYPSNLDVDAIDLISKLVVKDPNKRLSLKEVLNHNWIIKNKPKWPKNIYK

IPL1

Spindle assembly checkpoint kinase

412 amino acids

Required for high-fidelity chromosome segregation during the later part of each cell cycle. Acts in opposition to the phosphatase PP1. Has a role in attaching the kinetochores to the microtubules and ensuring that sister kinetochores connect to opposite poles. The promotion of bi-orientation is achieved by selectively detaching kinetochore-microtubule attachments that are not under tension. Phosphorylates histone H3 to form H3S10ph during mitosis and meiosis (By similarity).

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.

47.856 kDa

MYCRVFTHFSLYRLYTLSDNININKTNHNKSIGLHQHRVNYMPRSMTASSSQLKRIETRIESLSESLSKSNARKPLGKFQLNTFDNNKITKLQNEKVRPSKSSHIPVKSPIRKKGHSPAQVLQNERMDTKLLLQKLPSASRHMTLDDFEIGKVLGKGKLGKVYCVKHKTSGYIAALKVMAKKDLIDLKLEKNFRREIEIQSNLIHPKISRLYGFFYDHKNVYLILEYSIHGELYHHLKVQRRFNDATASHYIYQVALALDYLHTKHIIHRDIKPENILLSTDNCIKLSDFGWSVKSSPSSSTKRLTICGTLDYLPPEMIESNEHDYTVDIWSLGILCYEFLVGKPPFEEIDKNSTYKRIAKVDLKIPSFLSSEATDLILRLLQKSPKKRITLAEVMNHPWIMNNQQYWPNEN

IPL1

Spindle assembly checkpoint kinase

371 amino acids

Required for high-fidelity chromosome segregation during the later part of each cell cycle. Acts in opposition to the phosphatase PP1. Has a role in attaching the kinetochores to the microtubules and ensuring that sister kinetochores connect to opposite poles. The promotion of bi-orientation is achieved by selectively detaching kinetochore-microtubule attachments that are not under tension (By similarity).

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.

42.751 kDa

MSMKQLETSMSSVSLQEKKPTRIKIALHPQSKSEQNETDRASKIPTGRISTTQPQTYYRPTNLTKTPASQVSRRSSYTTDPPSPLTGITGFRNYSLDDFEIGKALGKGKFGKVYLVKDKKTGFVSALKCMEKKELVEGNVEKQFRREVEIQSNLRHTNVLRLFGHFHDKDRVYLILEYVVHGELYKLLRNQKRFTESTASSYIYQMSEALLYLHGKNIIHRDIKPENILLHFNDTIKISDFGWSVHAPSNRRSTLCGTMDYLPPEIVQSRPYDKNVDVWSLGILMYEFLCGAPPFEEPGGAQATYRRIVKLDLRIPPYVSADAADLIKRMLTLDPAKRFKLKDMHKHPWIVRLRPTWKYKVPKTASHERSA

IPL1

Spindle assembly checkpoint kinase

367 amino acids

Required for high-fidelity chromosome segregation during the later part of each cell cycle. Acts in opposition to the phosphatase PP1. Has a role in attaching the kinetochores to the microtubules and ensuring that sister kinetochores connect to opposite poles. The promotion of bi-orientation is achieved by selectively detaching kinetochore-microtubule attachments that are not under tension. Phosphorylates histone H3 to form H3S10ph during mitosis and meiosis. Phosphorylates RGD1 in vitro.

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.

42.946 kDa

MQRNSLVNIKLNANSPSKKTTTRPNTSRINKPWRISHSPQQRNPNSKIPSPVREKLNRLPVNNKKFLDMESSKIPSPIRKATSSKMIHENKKLPKFKSLSLDDFELGKKLGKGKFGKVYCVRHRSTGYICALKVMEKEEIIKYNLQKQFRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNIIHRDIKPENILIGFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPSNISQDAQDLILKLLKYDPKDRMRLGDVKMHPWILRNKPFWENKRL

IPL1

Spindle assembly checkpoint kinase

367 amino acids

Required for high-fidelity chromosome segregation during the later part of each cell cycle. Acts in opposition to the phosphatase PP1. Has a role in attaching the kinetochores to the microtubules and ensuring that sister kinetochores connect to opposite poles. The promotion of bi-orientation is achieved by selectively detaching kinetochore-microtubule attachments that are not under tension. Phosphorylates histone H3 to form H3S10ph during mitosis and meiosis (By similarity).

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.

42.445 kDa

MDADAILKKDQRRSSLKQRNLLLSMRLNQTTATNGAPPQARVQPGKGYRNPGKVLSPIRNQEMSPGKRPTLEISELKNVSPINQAHKTGKARAGGVPLSKLQNLKLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMADALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKGSKRKTLCGTVDYLSPELIRSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLIFPDHVDTEARHLISRLLEYDPGDRIPLKEVKKHPWIEKNKPFW

IPL1

Spindle assembly checkpoint kinase

361 amino acids

Required for high-fidelity chromosome segregation during the later part of each cell cycle. Acts in opposition to the phosphatase PP1. Has a role in attaching the kinetochores to the microtubules and ensuring that sister kinetochores connect to opposite poles. The promotion of bi-orientation is achieved by selectively detaching kinetochore-microtubule attachments that are not under tension. Phosphorylates histone H3 to form H3S10ph during mitosis and meiosis (By similarity).

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.

41.892 kDa

MRPSLSRDASDTGRRHSLLQQSKLLSIRLSNAGKRPSLSRGHAHEKDSITSSHHRLSTGPVNNNPRRSLMVKKPNTAHGTRVPILNDHNDKFENMTLQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSFKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANALDYMHSKNILHRDIKPENILIGFNNTIKLTDFGWSVYNEDGQKRKTLCGTIDYLSPELIKSREYNNKVDVWALGVLTYELLVGSPPFEEDTKEMTYRRILRCDLKFPLNVSPQARDLIVRLLQFEPSKRIPLSEVKSHAWIANNRGSWTDL

IPL1

Spindle assembly checkpoint kinase

358 amino acids

Required for high-fidelity chromosome segregation during the later part of each cell cycle. Acts in opposition to the phosphatase PP1. Has a role in attaching the kinetochores to the microtubules and ensuring that sister kinetochores connect to opposite poles. The promotion of bi-orientation is achieved by selectively detaching kinetochore-microtubule attachments that are not under tension. Phosphorylates histone H3 to form H3S10ph during mitosis and meiosis (By similarity).

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.

40.992 kDa

MENKATLARNIGEKRVSPRSKVNGTGKSWRISYSPQRMDGVSSGRNVSKIPSPVRERLFLKNQERKPLGVSPLSNLSPNSLGRNSLEKSTYNNKLSLKDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKREVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQIADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILNPEGSKRKTLCGTIDYLSPEMITPREYDEQVDVWALGVLAYELVVGVPPFEENSKELTYKRILKCDLNFPESISKDAKDLISKLLVTDTTQRLSLTGVKTHPWILKNKPFW

IPL1

Probable spindle assembly checkpoint kinase homolog

272 amino acids

Required for high-fidelity chromosome segregation during the later part of each cell cycle. Has a role in attaching the kinetochores to the microtubules and ensuring that sister kinetochores connect to opposite poles. The promotion of bi-orientation is achieved by selectively detaching kinetochore-microtubule attachments that are not under tension (By similarity).

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.

31.717 kDa

MVEYWTLDRFEIGRLLGRGKFGQVWLAREREKGFIVALKIIPIKEIQTVETARQIRREIEIHSNLKHPNILRMYGHFHDKDNIYLILEYAGKGEFFKFLSDRGGKFGEKETSLYIRQVMLALTYMKECNVIHRDIKPENLLLGSDNQLKIADFGWAVYNADKRRMTFCGTMEYLAPEMVNNDIHDSGIDLWCLGILTYEFLMGKTPFESKNRNMREAYKKINSLKYTIPETISSNASDFISRLLVLSPGDRMELTEALNHPFIVKHHGRSSD