Ing3

Inhibitor of growth protein 3

421 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome (By similarity).

Belongs to the ING family.

46.847 kDa

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDAPSQPVNNHHAHSHTPVEKRKYNPTSHHAAADHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASCNNAYNVNSSQPLASYNIGSLSSGAGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKEFSIPRETAGYSSSSALMTTLTQNASSSATDSRSGRKSKNNTKSSSQQSSSSSSSSSSSSLSLCSSSSTVVQEVSQQATVVPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWFCPQCTAAMKRRGSRHK

Ing3

Inhibitor of growth protein 3

421 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome (By similarity).

Belongs to the ING family.

46.925 kDa

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDAPSQPVNNHHAHSHTPVEKRKYNPTSHHTATDHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASCNNAYNVNSSQPLASYNIGSLSSGAGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKEFSMPRETAGYSSSSALMTTLTQNASSSAADSRSGRKSKNNTKSSSQQSSSSSSSSSSSSLSLCSSSSTVVQEVSQQTTVVPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWFCPQCTAAMKRRGSRHK

Ing3

Inhibitor of growth protein 3

421 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome (By similarity).

Belongs to the ING family.

46.847 kDa

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDAPSQPVNNHHAHSHTPVEKRKYNPTSHHAAADHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASCNNAYNVNSSQPLASYNIGSLSSGAGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKEFSIPRETAGYSSSSALMTTLTQNASSSATDSRSGRKSKNNTKSSSQQSSSSSSSSSSSSLSLCSSSSTVVQEVSQQATVVPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWFCPQCTAAMKRRGSRHK

Ing3

Inhibitor of growth protein 3

421 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome (By similarity).

Belongs to the ING family.

46.925 kDa

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDAPSQPVNNHHAHSHTPVEKRKYNPTSHHTATDHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASCNNAYNVNSSQPLASYNIGSLSSGAGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKEFSMPRETAGYSSSSALMTTLTQNASSSAADSRSGRKSKNNTKSSSQQSSSSSSSSSSSSLSLCSSSSTVVQEVSQQTTVVPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWFCPQCTAAMKRRGSRHK

ING3

Inhibitor of growth protein 3

418 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome.

Belongs to the ING family.

46.743 kDa

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASSNNAYNVNSSQPLGSYNIGSLSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSALMTTLTQNASSSAADSRSGRKSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK

ING3

Inhibitor of growth protein 3

418 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome.

Belongs to the ING family.

46.743 kDa

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASSNNAYNVNSSQPLGSYNIGSLSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSALMTTLTQNASSSAADSRSGRKSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK

ING3

Inhibitor of growth protein 3

417 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription (By similarity). NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage (By similarity).

Belongs to the ING family.

46.566 kDa

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVNEFFMNAKKNKPEWREEQMTSIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHSHTPVEKRKHNPSSHHGATDHVPEKKFKSEALLSTLTSDASKENTPGRRNNNSSSSSNNAYNTNSSQPLASYNLGSLSSGSGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGREFSLSRDSTGYSSSALASTLTQTLSSSSTDSRSGRKSKNNNKSSSQQSSSSSSSSSLSSCSSSSALAQELSQQTAVIPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK

ing3

Inhibitor of growth protein 3

417 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription (By similarity). NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage (By similarity).

Belongs to the ING family.

46.372 kDa

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVGEFFMNAKKNKPEWREEQMASIKKDYFKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHVHSHSLGEKRKHNPSSHHSTTDHVSEKKFKSEALLSTLTSDASKENTAGCRNNLSSSSTNNVYNVNASQPLTSYNISSLSTGAGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGISLSRDSATYSSSALASTLTQTLTSSATTDSRSGRKSKSNNKSASQQSSSSSSSSSLSSCSSSSALAHELSHQQTAAIPESDTNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLSEAPKGKWYCPQCTAAMKRRGSRHK

ING3

Inhibitor of growth protein 3

417 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription (By similarity). NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage (By similarity).

Belongs to the ING family.

46.566 kDa

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVNEFFMNAKKNKPEWREEQMTSIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHSHTPVEKRKHNPSSHHGATDHVPEKKFKSEALLSTLTSDASKENTPGRRNNNSSSSSNNAYNTNSSQPLASYNLGSLSSGSGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGREFSLSRDSTGYSSSALASTLTQTLSSSSTDSRSGRKSKNNNKSSSQQSSSSSSSSSLSSCSSSSALAQELSQQTAVIPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK

ing3

Inhibitor of growth protein 3

417 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription (By similarity). NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage (By similarity).

Belongs to the ING family.

46.372 kDa

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVGEFFMNAKKNKPEWREEQMASIKKDYFKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHVHSHSLGEKRKHNPSSHHSTTDHVSEKKFKSEALLSTLTSDASKENTAGCRNNLSSSSTNNVYNVNASQPLTSYNISSLSTGAGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGISLSRDSATYSSSALASTLTQTLTSSATTDSRSGRKSKSNNKSASQQSSSSSSSSSLSSCSSSSALAHELSHQQTAAIPESDTNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLSEAPKGKWYCPQCTAAMKRRGSRHK

ing3

Inhibitor of growth protein 3

416 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription (By similarity). NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage (By similarity).

Belongs to the ING family.

46.183 kDa

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVGEFFMNAKKNKPEWREEQMASIKKDYFKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHVHSHSSGEKRKHIPSSHHSTTDHVPEKKFKSEALLSTLTSDASKENTAGCRTNLSSSSTNNVYNVNSSQPLTSYNISSLSTGAAAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNTDLLGISLSRDSASYSSSALASTLTQTLTSSATTDSRSGRKSKSNNKSASQQSSSSSSSSSLSSCSSSSALAHELSHQQTAAIPESDTNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLSEAPKGKWYCPQCTAAMKRRGSRHK

ing3

Inhibitor of growth protein 3

416 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription (By similarity). NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage (By similarity).

Belongs to the ING family.

46.183 kDa

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVGEFFMNAKKNKPEWREEQMASIKKDYFKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHVHSHSSGEKRKHIPSSHHSTTDHVPEKKFKSEALLSTLTSDASKENTAGCRTNLSSSSTNNVYNVNSSQPLTSYNISSLSTGAAAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNTDLLGISLSRDSASYSSSALASTLTQTLTSSATTDSRSGRKSKSNNKSASQQSSSSSSSSSLSSCSSSSALAHELSHQQTAAIPESDTNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLSEAPKGKWYCPQCTAAMKRRGSRHK

ING3

Inhibitor of growth protein 3

403 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome (By similarity).

Belongs to the ING family.

44.86 kDa

MDLRDRFTEMREMDLQVQNAMDQLEQRASEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASSNNAYNVNSSQPLGSYNIGSLSSGTGAGAITMAAAQAVQATAQMREGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSALMTTLTQNASSSAADSRSGRKSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK

ING3

Inhibitor of growth protein 3

403 amino acids

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Component of a SWR1-like complex that specifically mediates the removal of histone H2A.Z/H2AFZ from the nucleosome (By similarity).

Belongs to the ING family.

44.86 kDa

MDLRDRFTEMREMDLQVQNAMDQLEQRASEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASSNNAYNVNSSQPLGSYNIGSLSSGTGAGAITMAAAQAVQATAQMREGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSALMTTLTQNASSSAADSRSGRKSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQVDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK