INCA1

Protein INCA1

236 amino acids

Binds to CDK2-bound cyclins and inhibits the kinase activity of CDK2; binding to cyclins is critical for its function as CDK inhibitor (PubMed:21540187). Inhibits cell growth and cell proliferation and may play a role in cell cycle control (By similarity). Required for ING5-mediated regulation of S-phase progression, enhancement of Fas-induced apoptosis and inhibition of cell growth (By similarity).

Belongs to the INCA family.

26.817 kDa

MQVQDDGVNLIPFAKCSRVVSRSPPPRLPSQSLRPMPQRYGDVFWKNLNQRPTPTWLEEQHIPPMLRATGCSQLGLYPPEQLPPPEMLWRRKKRRPCLEGMQQQGLGGVPARVRAVTYHLEDLRRRQSIINELKKAQWGSSGAASEPVVLGEEGCGFPSTNEYPDLEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASEE

Inca1

Protein INCA1

231 amino acids

Binds to CDK2-bound cyclins and inhibits the kinase activity of CDK2; binding to cyclins is critical for its function as CDK inhibitor. Inhibits cell growth and proliferation and may play a role in cell cycle control (PubMed:21540187). Required for ING5-mediated regulation of S-phase progression, enhancement of Fas-induced apoptosis and inhibition of cell growth (PubMed:21750715).

Belongs to the INCA family.

26.477 kDa

MQGQEDGDSILPFAKCSRVVSRFSPCSLPPQNRRPMPQPYGDAFWENLSQRSSSNWMVEQYIPPILRATDCSRPSLHPLEGLPPPEKLWRRKRKKLHLERMQKGPGSIPARVRAVTYHLEDLRRRQGIINELKRAQWGSSDATPELPALEEGFELLSTTKYFDVEEERATYPQKETYSVTPRDQLLWTPWTPVGQQGTYASGQLSSLTYSTATARKNPVYDPQAMELESEE