impact

Protein IMPACT homolog

345 amino acids

Translational regulator that ensures constant high levels of translation under amino acid starvation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. Plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.

Belongs to the IMPACT family.

40.338 kDa

MNEEQENEILAISSIYPDSFSEIETIVGEEENDGFEDNDSQYSKIYQVIITPNISCLDENSLEDNNNSNNNNNNNNNNNNNGLIIDTSYDYLIYFKFKYTKEYPSNEPPIISIKATWLQKSDQSILLSHLEDLWNQNELVIFQMISWLQEESIEILNNHYKSIKKFSHYHLKKSLNTQQLNQNQNQFENQNQNQNQNQNQNQNKEKEKEKVPTIYTGQSVTEKKSKFQAHLAIVHSEREVQLVLNQLLSFKKIYEATHNMYAYRFQLENGEINEYYNDDGEDGAGDKMLFTLSKNQAKEILIVCTRWFGGILLGGRRYVHIVNTTKDILNLYNTNSLSQCSLEFN

impact

Protein IMPACT homolog

345 amino acids

Translational regulator that ensures constant high levels of translation under amino acid starvation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. Plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.

Belongs to the IMPACT family.

40.338 kDa

MNEEQENEILAISSIYPDSFSEIETIVGEEENDGFEDNDSQYSKIYQVIITPNISCLDENSLEDNNNSNNNNNNNNNNNNNGLIIDTSYDYLIYFKFKYTKEYPSNEPPIISIKATWLQKSDQSILLSHLEDLWNQNELVIFQMISWLQEESIEILNNHYKSIKKFSHYHLKKSLNTQQLNQNQNQFENQNQNQNQNQNQNQNKEKEKEKVPTIYTGQSVTEKKSKFQAHLAIVHSEREVQLVLNQLLSFKKIYEATHNMYAYRFQLENGEINEYYNDDGEDGAGDKMLFTLSKNQAKEILIVCTRWFGGILLGGRRYVHIVNTTKDILNLYNTNSLSQCSLEFN

IMPACT

Protein IMPACT

320 amino acids

Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. May be required to regulate translation in specific neuronal cells under amino acid starvation conditions by preventing GCN2 activation and therefore ATF4 synthesis. Through its inhibitory action on EIF2AK4/GCN2, plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.

Belongs to the IMPACT family.

36.476 kDa

MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIQKSQMTEPGPDVKKKTEEEDVECEDDLILACQPESSLKALDFDISETRTEVEVEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLSKLYENKKIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILVEKNYTNSPEESSKALGKNKKVRKDKKRNEH

IMPACT

Protein IMPACT

320 amino acids

Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. May be required to regulate translation in specific neuronal cells under amino acid starvation conditions by preventing GCN2 activation and therefore ATF4 synthesis. Through its inhibitory action on EIF2AK4/GCN2, plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.

Belongs to the IMPACT family.

36.476 kDa

MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIQKSQMTEPGPDVKKKTEEEDVECEDDLILACQPESSLKALDFDISETRTEVEVEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLSKLYENKKIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILVEKNYTNSPEESSKALGKNKKVRKDKKRNEH

IMPACT

Protein IMPACT

318 amino acids

Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. May be required to regulate translation in specific neuronal cells under amino acid starvation conditions by preventing GCN2 activation and therefore ATF4 synthesis. Through its inhibitory action on EIF2AK4/GCN2, plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.

Belongs to the IMPACT family.

36.333 kDa

MAEGDTGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIQKSQMTEPGPDVKKKTEEEDVECEDDLVLACQPENQVKTLDFDVSENRTEIEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLAKLYENKKIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVRDVMVVVSRWYGGVLLGPDRFKHINNCARNILVEKNYTNSPEESSKALGKNKKVRKDKKRSEH

IMPACT

Protein IMPACT

318 amino acids

Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. May be required to regulate translation in specific neuronal cells under amino acid starvation conditions by preventing GCN2 activation and therefore ATF4 synthesis. Through its inhibitory action on EIF2AK4/GCN2, plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.

Belongs to the IMPACT family.

36.333 kDa

MAEGDTGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIQKSQMTEPGPDVKKKTEEEDVECEDDLVLACQPENQVKTLDFDVSENRTEIEELPPIDHGIPITDRRSTFQAHLAPVVCPKQVKMVLAKLYENKKIASATHNIYAYRIYCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVRDVMVVVSRWYGGVLLGPDRFKHINNCARNILVEKNYTNSPEESSKALGKNKKVRKDKKRSEH

Impact

Protein IMPACT

318 amino acids

Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis (PubMed:15937339, PubMed:23447528, PubMed:24333428). May be required to regulate translation in specific neuronal cells under amino acid starvation conditions by preventing GCN2 activation and therefore ATF4 synthesis (PubMed:15937339, PubMed:23447528). Through its inhibitory action on EIF2AK4/GCN2, plays a role in differentiation of neuronal cells by stimulating neurite outgrowth (PubMed:23447528).

Belongs to the IMPACT family.

36.276 kDa

MAEEEVGNSQRQSEEIEAMAAIYGEEWCVIDENAKIFCIRVTDFMDDPKWTLCLQVMLPSEYPGTAPPSYQLNAPWLKGQERADLSNSLEEIYVHNMGESILYQWVEKIRDALIQKSQITEPDPDVKKKTEEVEVESEEDPILEHPPENPVKTLDLKISEETQPETEELPPVAHGVPITDRRSTFQAHVAPVVCPEQVKLVLAKLYENKKIASATHNIYAYRIFCEDKQTFLQDCEDDGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILVEKNFTNTPDESTKNLGKKKVKKDKKKNDH

impact

Protein IMPACT

317 amino acids

Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. Plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.

Belongs to the IMPACT family.

35.901 kDa

MDKLEDHDDNNLQSQIEEIEALSSIYGEEWCVIDEAARVFCIRISETQQPKWTVCLQIILPPDYPSSAPPIYQINAAWLRGQDRMTLSNSLEEIYVENAGESILYLWVEKIREFLTEKSQHSDGPDTCKTVMTEEGGHDCDEDDLPDISVLKLSSQSEQIFSPASDDEELPLIKHGESITDRRSTFQPHLSAVENPKQVQRVLNKLYENKKIASATHNIYAYRIYCQEKNSVLQDCEDDGETAAGGRLLHLLQILDVRNVLVVVSRWYGGILLGPDRFKHINNCARTILIQEGYADSTEETSKAGGKSKKPKSKKTK

impact

Protein IMPACT

317 amino acids

Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. Plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.

Belongs to the IMPACT family.

35.901 kDa

MDKLEDHDDNNLQSQIEEIEALSSIYGEEWCVIDEAARVFCIRISETQQPKWTVCLQIILPPDYPSSAPPIYQINAAWLRGQDRMTLSNSLEEIYVENAGESILYLWVEKIREFLTEKSQHSDGPDTCKTVMTEEGGHDCDEDDLPDISVLKLSSQSEQIFSPASDDEELPLIKHGESITDRRSTFQPHLSAVENPKQVQRVLNKLYENKKIASATHNIYAYRIYCQEKNSVLQDCEDDGETAAGGRLLHLLQILDVRNVLVVVSRWYGGILLGPDRFKHINNCARTILIQEGYADSTEETSKAGGKSKKPKSKKTK

IMPACT

Protein IMPACT

317 amino acids

Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. May be required to regulate translation in specific neuronal cells under amino acid starvation conditions by preventing GCN2 activation and therefore ATF4 synthesis. Through its inhibitory action on EIF2AK4/GCN2, plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.

Belongs to the IMPACT family.

36.094 kDa

MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPNEYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIEKSQMTEPGPEVKKKTEEVVVECEDDPIVPPQPENSAKAVDVRVREKPREVEEIPPIDHGVPITDRRSTFQAHLAPVVCPEQVKMVLSKLYENKKISSATHNIYAYRIYCEDKQTFLQDSEDDGETAAGGRLLHLMEILNVRNVLVVVSRWYGGILLGPDRFKHINNCARNILVEKNYTSSPEESSKALGKNKKMKNKKRNEH

Impact

Protein IMPACT

317 amino acids

Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. May be required to regulate translation in specific neuronal cells under amino acid starvation conditions by preventing GCN2 activation and therefore ATF4 synthesis. Through its inhibitory action on EIF2AK4/GCN2, plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.

Belongs to the IMPACT family.

35.995 kDa

MAEVESGSNQRQNEEIEAMAAIYGEEWCVIDEVAKIFCIRITDDMDDPKWTLCLQVMLPSEYPGTAPPVYQLNAPWLKGQERAELAKSLEEIYMKNIGESILYQWVEKIRDALIQKSQITEPGPDEKKKTEEEEVEGEDDPILEHPPENPVKTWDLKISESAPEAEELPPIAHGAPITDRRSTFQAHLAPVVCIDQVKKVLAKLYENKKIASATHNIYAYRIYCEDKQTFLQDSEDDGETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILVEKNFTNSPEESAKSFGKKKVKKDKKKGDH

impact

Protein IMPACT

312 amino acids

Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. Plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.

Belongs to the IMPACT family.

35.64 kDa

MADTEEENVQRQIDEVEALTSIYGDEWCVIDEAERIFCITISDSSNKPTWTLCLQVILPPDYPVASPPLYQLNAPWLRGEDRLTLSNCLEEMYLQNLGENILYQWVEKIREFLVEKSQTSDPGPSLKSTSEETDVGDDCEVSTDELTESFKNSMIFGMNYSSGVEEIPPIVHGETISDRRSTFQAHLAPVVSPYQVKLILNKLYENKKIATATHNIYAYRIYIKERNSFIQDCEDDGETAAGKRMLHLMQILDARDVMVVVSRWYGGILLGPDRFKHINNCARNVLMEHNYCSTVEESSKQTSKSKKSSQRK