imp1

Importin subunit alpha-2

539 amino acids

Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Active directional transport is assured by both, a Phe-Gly (FG) repeat affinity gradient for these transport factors across the NPC and a transport cofactor concentration gradient across the nuclear envelope. Involved in nuclear protein import. Required for efficient nuclera import of both an SV40 nuclear localization signal-containing reporter protein and the pap1 component of the stress response MAP kinase pathway. Required for proper mitotic progression.

Belongs to the importin alpha family.

59.853 kDa

MESRYLSDRRSRFKSKGVFKADELRRQREEQQIEIRKQKREESLNKRRNLNAVLQNDIDVEEEADQSQVQMEQQMKDEFPKLTADVMSDDIELQLGAVTKFRKYLSKETHPPIDQVIACGVVDRFVQFLESEHHLLQFEAAWALTNIASGTTDQTRIVVDSGAVPRFIQLLSSPEKDVREQVVWALGNIAGDSSACRDYVLGNGVLQPLLNILQSSASDVSMLRNATWTLSNLCRGKNPPPNWSTISVAVPILAKLLYSEDVEIIVDACWAISYLSDGPNEKIGAILDVGCAPRLVELLSSPSVNIQTPALRSVGNIVTGTDAQTQIIIDCGALNAFPSLLSHQKENIRKEACWTISNITAGNTQQIQAIIESNLIPPLVHLLSYADYKTKKEACWAISNATSGGLGQPDQIRYLVSQGVIKPLCDMLNGSDNKIIQVALDAIENILKVGEMDRTMDLENINQYAVYVEEAGGMDMIHDLQSSGNNDIYLKAYSIIEKYFSDEDAVEDLAPETENGAFTFGNGPQAQGEFKFDSQDMAM

IMP1

Inositol monophosphatase 1

273 amino acids

Responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides.

Belongs to the inositol monophosphatase superfamily.

29.559 kDa

MARNGSLEEFLGVAVDAAKRAGEIIRKGFHETKHVVHKGQVDLVTETDKACEDLIFNHLKQHFPSHKFIGEETSAATGDFDLTDEPTWIVDPVDGTTNFVHGFPSVCVSIGLTIGKIPTVGVVYDPIIDELFTGINGKGAYLNGKPIKVSSQSELVKSLLGTEVGTTRDNLTVETTTRRINNLLFKVRSLRMCGSCALDLCWVACGRLELFYLIGYGGPWDVAGGAVIVKEAGGVLFDPSGSEFDITSQRVAATNPHLKEAFVEALQLSEYVS

IMP1

Inositol monophosphatase

270 amino acids

Responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides.

Belongs to the inositol monophosphatase superfamily.

29.161 kDa

MAANVPLSDFLATAVDAAKRAGEVIRKGFYVKKNVEHKGQVDLVTETDKSCEDIIFNCLKQQYPNHKFIGEETTAAYGATELTDEPTWIVDPLDGTTNFVHGFPFVCVSIGLTIGKVPTVGVVYNPIMNELFTGVRRQGAFLNGVPIHVSSKDELVNCLLVTEVGTKRDKSTVDATTNRINGLLFKVRSIRMAGSCALDLCGIACGRADLMYENGYGGAWDVTAGIVIVEEAGGVIFDPSGKDFDITVTRIAASNPLIKDSFVEAFKQAE

IMP1

Mitochondrial inner membrane protease subunit 1

190 amino acids

Catalytic component of the mitochondrial inner membrane peptidase (IMP) complex. IMP catalyzes the removal of signal peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. The two catalytic IMP subunits seem to have non-overlapping substrate specificities. IMP1 substrates include nuclear encoded CYB2, mitochondrially encoded COX2, NADH-cytochrome b5 reductase and GUT2.

Belongs to the peptidase S26 family. IMP1 subfamily.

21.433 kDa

MTVGTLPIWSKTFSYAIRSLCFLHIIHMYAYEFTETRGESMLPTLSATNDYVHVLKNFQNGRGIKMGDCIVALKPTDPNHRICKRVTGMPGDLVLVDPSTIVNYVGDVLVDEERFGTYIKVPEGHVWVTGDNLSHSLDSRTYNALPMGLIMGKIVAANNFDKPFWDGSIRNIWGFKWINNTFLDVQAKSN

imp1

Mitochondrial inner membrane protease subunit 1

157 amino acids

Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space.

Belongs to the peptidase S26 family. IMP1 subfamily.

17.269 kDa

MAGMFRIPIAVVQIAAFVHQIHEYLFQVQMTSGPSMMPTLNSGGEFVLLDKLHGRFARSCSVGDVVVSAKPSDSKQHVCKRIIGMPGDTIYVDPTSSNKKITIPLGHVWLAGDNIAHSLDSRNYGPVPMGLIKAKVIARVWPHPHWMSNILNDIDVE