ikzf1

DNA-binding protein Ikaros

522 amino acids

Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Functions in the specification and the maturation of the T-lymphocyte. Also interacts with a critical control element in the TDT (terminal deoxynucleotidyltransferase) promoter as well as with the promoters for other genes expressed during early stages of B- and T-cell development. Function is isoform-specific and is modulated by dominant-negative inactive isoforms (By similarity).

Belongs to the Ikaros C2H2-type zinc-finger protein family.

57.658 kDa

MEMEEAQEMSQMPGRDSPPPNDVSEENDEAMPIPEDLSASSNLQHNNRGDKEGLACNIKVEARCDEENGLAIDMMMNGEEEEECAEDLRVLDASGAKVNGSHAGGPDSKGPYSSAGGIRLPNGKLKCDICGIVCIGPNVLMVHKRSHTGERPFQCTQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALSGHLRTHSVGKPHKCAYCGRSYKQRSSLEEHKERCHNYLQCMGLQNSIYTVVKEESNQNEQREDLSQMGSKRALVLDRLANNVAKRKSTMPQKFVGEKRFSNISFEGGPGELMQPHVIDQAINSAINYLGAESLRPLIQTSPTSSDMGVMGSMYPLHKPPAEGHGLSAKDSAAENLLLLAKSKSASSEKDGSPSHSGQDSTDTESNNEEKAGVGASGLIYLTNHITSGVRNGVLPLVKEEQQRQYEAMRASIEIASEGFKVLSGEGEQVRAYRCEHCRILFLDHVMYTIHMGCHGFRDPFECNLCGHRSQDRYEFSSHMTRGEHRY

ikzf1

DNA-binding protein Ikaros

522 amino acids

Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Functions in the specification and the maturation of the T-lymphocyte. Also interacts with a critical control element in the TDT (terminal deoxynucleotidyltransferase) promoter as well as with the promoters for other genes expressed during early stages of B- and T-cell development. Function is isoform-specific and is modulated by dominant-negative inactive isoforms (By similarity).

Belongs to the Ikaros C2H2-type zinc-finger protein family.

57.658 kDa

MEMEEAQEMSQMPGRDSPPPNDVSEENDEAMPIPEDLSASSNLQHNNRGDKEGLACNIKVEARCDEENGLAIDMMMNGEEEEECAEDLRVLDASGAKVNGSHAGGPDSKGPYSSAGGIRLPNGKLKCDICGIVCIGPNVLMVHKRSHTGERPFQCTQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALSGHLRTHSVGKPHKCAYCGRSYKQRSSLEEHKERCHNYLQCMGLQNSIYTVVKEESNQNEQREDLSQMGSKRALVLDRLANNVAKRKSTMPQKFVGEKRFSNISFEGGPGELMQPHVIDQAINSAINYLGAESLRPLIQTSPTSSDMGVMGSMYPLHKPPAEGHGLSAKDSAAENLLLLAKSKSASSEKDGSPSHSGQDSTDTESNNEEKAGVGASGLIYLTNHITSGVRNGVLPLVKEEQQRQYEAMRASIEIASEGFKVLSGEGEQVRAYRCEHCRILFLDHVMYTIHMGCHGFRDPFECNLCGHRSQDRYEFSSHMTRGEHRY

IKZF1

DNA-binding protein Ikaros

519 amino acids

Transcription regulator of hematopoietic cell differentiation (PubMed:17934067). Binds gamma-satellite DNA (PubMed:17135265, PubMed:19141594). Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs) (By similarity). Function is isoform-specific and is modulated by dominant-negative inactive isoforms (PubMed:17135265, PubMed:17934067).

Belongs to the Ikaros C2H2-type zinc-finger protein family.

57.528 kDa

MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGTLYPVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQLHKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS

IKZF1

DNA-binding protein Ikaros

519 amino acids

Transcription regulator of hematopoietic cell differentiation (PubMed:17934067). Binds gamma-satellite DNA (PubMed:17135265, PubMed:19141594). Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs) (By similarity). Function is isoform-specific and is modulated by dominant-negative inactive isoforms (PubMed:17135265, PubMed:17934067).

Belongs to the Ikaros C2H2-type zinc-finger protein family.

57.528 kDa

MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGTLYPVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQLHKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS

IKZF1

DNA-binding protein Ikaros

518 amino acids

Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Functions in the specification and the maturation of the T-lymphocyte. Also interacts with a critical control element in the TDT (terminal deoxynucleotidyltransferase) promoter as well as with the promoters for other genes expressed during early stages of B- and T-cell development. Function is isoform-specific and is modulated by dominant-negative inactive isoforms (By similarity).

Belongs to the Ikaros C2H2-type zinc-finger protein family.

57.586 kDa

METDEAQDMSQVSGKESPPISDVPDDADEPMPVPEDLSTTTGGQQSVKNERVLAGNIKIETQSDEENGRACEMNGEECAEDLRMLDASGDKMNGSHNGPGSKAMSGVGGIRLPNGKLKCDICGIICIGPNVLMVHNRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLQTMSISSNLYSVIKEETNQSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFVGEKCLSDLPYDATTNYEKENEIMQTHVIDQAINNAISYLGAESLRPLVQTPPVGSEVVPVISPMYQLHKPLGDNQTRSNHTAQDSAVENLLLLSKAKSVSSERDASPSNSCQDSTDTESNNEERSGLIYLTNHIGPHARNGISVKEESRQFDVLRAGTDNSQDAFKVISSNGEQVRVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRFHMS

Ikzf1

DNA-binding protein Ikaros

517 amino acids

Transcription regulator of hematopoietic cell differentiation. Binds gamma-satellite DNA. Binds with higher affinity to gamma satellite A. Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (terminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells (By similarity). Confers early temporal competence to retinal progenitor cells (RPCs). Function is isoform-specific and is modulated by dominant-negative inactive isoforms (By similarity).

Belongs to the Ikaros C2H2-type zinc-finger protein family.

57.336 kDa

MDVDEGQDMSQVSGKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMGSNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIVCIGPNVLMVHKRSHTERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGVCPVIKEETNHNEMAEDLCKIGAERSLVLDRLASNVAKRKSSMPQKFLGDKCLSDMPYDSANYEKEDMMTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPPSDGPPRSNHSAQDAVDNLLLLSKAKSVSSEREASPSNSCQDSTDTESNAEEQRSGLIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVSTSGEQLKVYKCEHCRVLFLDHVMYTIHMGCHGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRYHLS

Ikzf1

DNA-binding protein Ikaros

517 amino acids

Transcription regulator of hematopoietic cell differentiation. Binds gamma-satellite DNA. Binds with higher affinity to gamma satellite A. Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (terminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells (By similarity). Confers early temporal competence to retinal progenitor cells (RPCs). Function is isoform-specific and is modulated by dominant-negative inactive isoforms (By similarity).

Belongs to the Ikaros C2H2-type zinc-finger protein family.

57.336 kDa

MDVDEGQDMSQVSGKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMGSNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIVCIGPNVLMVHKRSHTERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGVCPVIKEETNHNEMAEDLCKIGAERSLVLDRLASNVAKRKSSMPQKFLGDKCLSDMPYDSANYEKEDMMTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPPSDGPPRSNHSAQDAVDNLLLLSKAKSVSSEREASPSNSCQDSTDTESNAEEQRSGLIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVSTSGEQLKVYKCEHCRVLFLDHVMYTIHMGCHGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRYHLS