ICK

Serine/threonine-protein kinase ICK

632 amino acids

Required for ciliogenesis (PubMed:24797473). Phosphorylates KIF3A (By similarity). Involved in the control of ciliary length (PubMed:24853502). Regulates the ciliary localization of SHH pathway components as well as the localization of IFT components at ciliary tips (By similarity). May play a key role in the development of multiple organ systems and particularly in cardiac development (By similarity). Regulates intraflagellar transport (IFT) speed and negatively regulates cilium length in a cAMP and mTORC1 signaling-dependent manner and this regulation requires its kinase activity (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

71.427 kDa

MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALRYPYFQVGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWADLDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSSSTSSSGLTGNYVPSFLKKEIGSAMQRVHLAPIPDPSPGYSSLKAMRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRTDWASKYASRR

Ick

Serine/threonine-protein kinase ICK

629 amino acids

Has an essential role in ciliogenesis, particularly in neuronal and retinal progenitor cells (PubMed:24797473). Phosphorylates KIF3A (PubMed:24797473). Involved in the control of ciliary length (PubMed:24853502). Regulates the ciliary localization of SHH pathway components as well as the localization of IFT components at ciliary tips (PubMed:24797473, PubMed:24853502). May play a role in cardiac development (By similarity). Regulates intraflagellar transport (IFT) speed and negatively regulates cilium length in a cAMP and mTORC1 signaling -dependent manner and this regulation requires its kinase activity (PubMed:25243405).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

70.592 kDa

MNRYTTIKQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANIVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDIWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFLWPQCIPNNLKTLIPNASSEAIQLLRDLLQWDPKKRPTASQALRYPYFQIGHPLGIISKDSGKPQREVQDKTGPPPYIKPAPPAQAPAKAYTLISSRPSQASQPPQHSVHPYKGDVSRTEQLSHVQEGKPSPPFFPSLHNKNLQPKILASLEQKNGEIKPKSRRRWGLISRSTKGSDDWADLDDLDFSPSLTRIDVKNKKRQSDDTLCRFESVLDLKPSESVGTGTTVSTQASSQRRDTPTLQSSAKQHYLKHSRYLPGINIRNGVLPNPGKDFLPSNSWSSSGLSGKSSGTVSVVSKITSVGSGSASSSGLTGSYIPSFLKKEIGSVMQRVQLAPLAAPPPGYSSLKAVRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRIDWSSKYPSRR

Ick

Serine/threonine-protein kinase ICK

629 amino acids

Required for ciliogenesis, particularly in neuronal and retinal progenitor cells (By similarity). Phosphorylates KIF3A (By similarity). Involved in the control of ciliary length (By similarity). Regulates the ciliary localization of SHH pathway components as well as the localization of IFT components at ciliary tips (By similarity). May play a role in cardiac development (PubMed:8570168). Regulates intraflagellar transport (IFT) speed and negatively regulates cilium length in a cAMP and mTORC1 signaling-dependent manner and this regulation requires its kinase activity (By similarity).

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

70.569 kDa

MNRYTTIKQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANIVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFIWPQCIPNNLKTLIPNASSEAIQLLRDLLQWDPKKRPTASQALRYPYFQIGHPLGISTQDSGKPQKDVQDKTGPPPYVKPAPPAQAPTKAHTLISSRPNQASQPHQHFVYPYKGEASRTEQLSHVQEGQPNPPFFPSLHNKNLPPKILAGLEQKSGDMKPKSRRRWGLISRSTKGSDDWADLADLDFSSSLTRIDVKNKKRQSDDPLCRFESVLDLKPSEPVGTGTSVSTQASSQRRDTPTLQSTAKQHYLKHSRYLPGINIRNGVLPNPGKDFLPSSSWSSSGLSGKSSGTVSVVSKITSVGSGSTSSTGLTGSYIPSFLKKEVGSVMQRVQLAPLAAPSPGYSSLKAVRPHPGRPFFHTQPRSTPGLIPRPPAVQPVHGRIDWSSKYPSRR