About Products Protein Database Contact

Htur_2490

Gene
Htur_2490
Protein
HGPRTase-like protein 3
Organism
Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734)
Length
186 amino acids
Function
May catalyze a purine salvage reaction, the substrate is unknown.
Similarity
Belongs to the purine/pyrimidine phosphoribosyltransferase family. Archaeal HPRT subfamily.
Mass
19.963 kDa
Sequence
MDPTLKQLARSLREAPVVDRDGYEYFVHGVTDGVPPLDPAVLEAIADGIRERIDLEGVDTLVAPEAMGIHHGTALSLATRIPLVVVRKRSYGFPEEVAVHQETSYGESDLYLNGVDAGDRVVVVDDVLSSGGTIEAVCEALEAVGAEIVDIVTVLRRVDADHGDISRPVTSLLDVRVRDGALEVVE