HNRNPDL

Heterogeneous nuclear ribonucleoprotein D-like

420 amino acids

Acts as a transcriptional regulator. Promotes transcription repression. Promotes transcription activation in differentiated myotubes (By similarity). Binds to double- and single-stranded DNA sequences. Binds to the transcription suppressor CATR sequence of the COX5B promoter (By similarity). Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Binds both to nuclear and cytoplasmic poly(A) mRNAs. Binds to poly(G) and poly(A), but not to poly(U) or poly(C) RNA homopolymers. Binds to the 5'-ACUAGC-3' RNA consensus sequence.

46.438 kDa

MEVPPRLSHVPPPLFPSAPATLASRSLSHWRPRPPRQLAPLLPSLAPSSARQGARRAQRHVTAQQPSRLAGGAAIKGGRRRRPDLFRRHFKSSSIQRSAAAAAATRTARQHPPADSSVTMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY

Hnrnpdl

Heterogeneous nuclear ribonucleoprotein D-like

322 amino acids

Acts as a transcriptional regulator. Promotes transcription repression. Promotes transcription activation in differentiated myotubes. Binds to double- and single-stranded DNA sequences. Binds to the transcription suppressor CATR sequence of the COX5B promoter. Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Binds both to nuclear and cytoplasmic poly(A) mRNAs. Binds to poly(G) and poly(A), but not to poly(U) or poly(C) RNA homopolymers. Binds to the 5'-ACUAGC-3' RNA consensus sequence (By similarity).

35.294 kDa

MTGTARSALPLPQSPARALRPSGAARAAPSLSPSRFSACPLDPSSFPTSGNKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGARGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGDESYSGYGGYDYTGYNYGSYGYGQGYTDYSGQQSTYGKASRGGGNHQNNYQPY

Hnrnpdl

Heterogeneous nuclear ribonucleoprotein D-like

301 amino acids

Acts as a transcriptional regulator. Promotes transcription repression (By similarity). Promotes transcription activation in differentiated myotubes. Binds to double- and single-stranded DNA sequences (By similarity). Binds to the transcription suppressor CATR sequence of the COX5B promoter. Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs (By similarity). Binds both to nuclear and cytoplasmic poly(A) mRNAs (By similarity). Binds to poly(G) and poly(A), but not to poly(U) or poly(C) RNA homopolymers (By similarity). Binds to the 5'-ACUAGC-3' RNA consensus sequence (By similarity).

33.559 kDa

MEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGARGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY

HNRNPDL

Heterogeneous nuclear ribonucleoprotein D-like

301 amino acids

Acts as a transcriptional regulator. Binds DNA and RNA (By similarity).

33.444 kDa

MEDATEMSGGAEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVEKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGKSNASGGRGGGRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYSDQSYSGYGGYDYSGYNYPNYGYGPGYTDYSGQQSTYGKASRGGGNHQNNYQPY

hnrnpdl

Heterogeneous nuclear ribonucleoprotein D-like

297 amino acids

Acts as a transcriptional regulator. Binds DNA and RNA (By similarity).

33.058 kDa

MTGFGATPDFNEGSKINASKNQQDEGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAVSVDKVLETKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPETTEEQIKQYFGGFGEIENIELPMDTKTNERRGFCFVTYTGEEPVKKLLESRFHQIGTGKCEIKVAQPKEVYRQQQQKQQKGGRGAATGRGGARGRGRGQGWNQGYSNYYDQNYGSYGNNGSYADQGYNNSYSGYDYSGYNYGSYGYNQGYTDYSGQQSTYGKARGGGNHQNNYQPY