Function
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling (By similarity).
Sequence
MSTDQEKIIKQVLDSIAEQQGDSRDDEVYVIEIMSLRFEKFDNRIKQKIERFTSLQMLTINDCLISDLTNFPHVPSLIRLDLVFNKITGDQLQYLRGSRHLQTLMLGANQIEEIEDLKRLGQMRELIQLDLLNNPVVNTNNYRNLVFNLFPSLVILDTLDKNGIDQEKAALDISASRVPDNLFDKSKPVQNVSKQVVKNAKATQNNLFSSTQKVAQVKQIPKIVPAKVSKPSQASVQDNKSNVVQAKVTAAVSVGRKAPASRNGGVPSKAGKGKMNAFSKQSTSQKSGLVFPCGRLRRYLKQACKQFRVSSSCNIYLAGVLEYLAAEVLETAGNIAKNNRLSRINPVHIREAFRNDAELNQFVNGTIIAEGGSTSTNFVLPIINKSKK